Identifiers and Description

Gene Model Identifier

TTHERM_00841210

Standard Name

p28A

Aliases

PreTt16206 | 147.m00058 | 3741.m00004

Description

Light chain subunit of inner arm dynein (IAD) complex 2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF02183 ) Homeobox associated leucine zipper
  • ( PF04325 ) Protein of unknown function (DUF465)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 20.3%

TetraMine Data

TTHERM_00841210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18960.17.996875492733741e-171hypothetical protein (247 aa)
OxytrichaContig21381.0.g787.996458382256093e-94Axonemal dynein light chain
WormBaseWBGene000183073.999458587140588e-43locus:dyla-1 status:Partiall
y_confirmed UniProt:Q95YA5
protein_id:CCD71054.1
Stentor CoeruleusSteCoe_154638.194012623990515e-40

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00841210(coding)
ATGCAACCTCCACCAAATATCACAACTCCTAATTCACTTGTTAAGTACGCAAGTGCAGTA
CTTGTTTCTACAAGTGGTAAGCGTAACCTTCTTGATAAGCAAAAAGGCAAAGCACCCAAT
AGCATCACTAATGCCCAAACAGAAGATATCTTGAACAGTATTTTACCCCCTAGAGAATAC
ACTATGGATAAGCAATAGTTATGGATTTAAAGTGTTAGTGCTACTCCTGCAACTAGGGCT
GATGTTTTAGAATTATAAAGCAATCTTGATAAAAAATTATAATAAAGATAAGCAAGAGAG
ACAGGTATTTGCCCAATTAGAGAAGAACTTTATGCTTAATGCTTTGATGAATTAATTAGA
TAAATTACAATTAATTGTGCAGAAAGAGGTTTGTTGTTAGTTAGAGTTAGAGACGAAATC
AAGCATACAATTCAAGCCTACCAAACACTTTATGAAAGCTCTATAGCTTATGGAATGAGA
AAGGCATTGTAGGCTGAATAAAAGAAAGCAGAAATGGAAAGTAAAAAGAAATAGCTTGAA
GTAGAATGCAACGAATTATCAAAATAAGTTGAAACATTAGAAAAAAAGATAGAAGAAATA
GAGCAAAACGACTAAGAATAAAGAGAAAATGATGAAAAAATGCATGCTGAATAAGTTGAT
CATCTTAAAAAAACTAATCAAAGATTTAAAGAAGAGTTGGAAAAGTTACTTTCTGGCCCT
TAACCCCAAGCTAAAAAATGA


>TTHERM_00841210(protein)
MQPPPNITTPNSLVKYASAVLVSTSGKRNLLDKQKGKAPNSITNAQTEDILNSILPPREY
TMDKQQLWIQSVSATPATRADVLELQSNLDKKLQQRQARETGICPIREELYAQCFDELIR
QITINCAERGLLLVRVRDEIKHTIQAYQTLYESSIAYGMRKALQAEQKKAEMESKKKQLE
VECNELSKQVETLEKKIEEIEQNDQEQRENDEKMHAEQVDHLKKTNQRFKEELEKLLSGP
QPQAKK


>TTHERM_00841210(gene)
ATGCAACCTCCACCAAATATCACAACTCCTAATTCACTTGTTAAGTACGCAAGTGCAGTA
CTTGTTTCTACAAGTGGTAAGCGTAACCTTCTTGATAAGCAAAAAGGCAAAGCACCCAAT
AGCATCACTAATGCCCAAACAGAAGATATCTTGAACAGTATTTTACCCCCTAGAGAATAC
ACTATGGATAAGCAATAGTTATGGATTTAAAGTGTTAGTGCTACTCCTGCAACTAGGGCT
GATGTTTTAGAATTATAAAGCAATCTTGATAAAAAATTATAATAAAGATAAGCAAGAGAG
ACAGGTATTTGCCCAATTAGAGAAGAACTTTATGCTTAATGCTTTGATGAATTAATTAGA
TAAATTACAATTAATTGTGCAGAAAGAGGTTTGTTGTTAGTTAGAGTTAGAGACGAAATC
AAGCATACAATTCAAGTAAAAAATTTTCAAATTTAAGCAAATTTTAGTCAAGAATTAATA
GGCAATTTTATTTAGAAATAGTATTTAATAAATAAAATAATTTCAAAGTGTTAATTGTAA
ATAATCAATAAAAATTGCTTATTTTTTTGGTTTAAACAATTTAAAATTTAATTTGAAAAA
ATAATAAAATCAGGCCTACCAAACACTTTATGAAAGCTCTATAGCTTATGGAATGAGAAA
GGCATTGTAGGCTGAATAAAAGAAAGCAGAAATGGAAAGTAAAAAGAAATAGCTTGAAGT
AGAATGCAACGAATTATCAAAATAAGTTGAAACATTAGAAAAAAAGATAGAAGAAATAGA
GCAAAACGACTAAGAATAAAGAGAAAATGATGAAAAAATGCATGCTGAATAAGTTGATCA
TCTTAAAAAAACTAATCAAAGATTTAAAGAAGAGTTGGAAAAGTTACTTTCTGGCCCTTA
ACCCCAAGCTAAAAAATGA