Identifiers and Description

Gene Model Identifier

g8950

Standard Name

JUB3 (JUnk Buster)

Aliases

None

Description

Heterochromatin Body Component Jub3p

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?:

A PHP Error was encountered

Severity: Notice

Message: Trying to get property of non-object

Filename: feature/featureDetailsView.php

Line Number: 296

No
Presense Probability:

A PHP Error was encountered

Severity: Notice

Message: Trying to get property of non-object

Filename: feature/featureDetailsView.php

Line Number: 297

0%

TetraMine Data

g8950

WebApollo

A PHP Error was encountered

Severity: Notice

Message: Undefined variable: webapollo

Filename: feature/featureDetailsView.php

Line Number: 338

&tracks=DNA%2CmRNA%2Cgene%2CCDS%2Cexon">Fullscreen View

A PHP Error was encountered

Severity: Notice

Message: Undefined variable: webapollo

Filename: feature/featureDetailsView.php

Line Number: 340

&tracks=DNA%2CmRNA&nav=0&overview=0" width="700px" height="200px" type="text/html">

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

Paragraph NoGene NameParagraph Text
111JUB1,
COI16,
JUB6,
COI6,
COI3,
HPL2,
JUB4,
JUB2,
JUB3
This protein co-localizes with Pdd1p in heterochromatin body in the new macronucleus.

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>g8950(protein)
MSFIEKIEYEIEKYFHSSGVKEGFETLQNDFKQYTLEKNTQFQDIRKHLETLQQESLQTE
IKIVTENQIKDACFLYIDGISLIGVVSKNQIYVFYSSDSASSNINLMSQHTIQFNISDNP
YQYQSYPKSKQKIVNFVKGYRESVFPKTEEDLYSCDFFDLHLEKNIYTGVIAGGMTGFIH
FVDIQSSTNQICFQVHGDTIFDIKCLNRNQSCQDYKNIVVSASKDGSIFLSHLAKQEKLI
QLKDFLSTSPMSQFTCIDIDLACENIFSACGDGTIQVWQLSEQIKKILLLKTPVNNFVKI
EKSQYNYQVQAQEDIMHTVQVTQCSFYGKYLLYLNSQGYITLGTFIEPYVYKAQYRMRKF
DKDNTGKNLKFFQITNFDLGSKVENYNKVMHVDQKNGLVWIGKQQSIFCFDLKDRRNSEI
DYNYSKPLIAYNTFIKANIQKIFFNENYSVLYILTDAKQLIKFSFIPNK


>g8950(coding)
ATGAGCTTTATAGAAAAAATAGAATATGAAATTGAAAAATATTTCCACTCAAGTGGTGTA
AAAGAAGGATTCGAAACTCTTTAAAATGATTTTAAATAATATACTCTTGAGAAAAATACC
TAATTCTAAGATATTAGGAAACACTTAGAGACTCTTTAATAAGAGAGCTTATAAACAGAA
ATTAAGATAGTCACTGAGAATTAAATAAAAGATGCTTGCTTTCTGTATATAGATGGAATT
AGCCTTATAGGAGTAGTGAGTAAAAATTAAATTTATGTCTTCTATTCAAGTGATTCAGCT
TCTTCAAACATAAATTTAATGTCTTAGCATACTATTTAATTTAACATAAGCGATAATCCC
TATTAGTACTAAAGTTATCCAAAGAGCAAGTAAAAAATAGTTAATTTCGTTAAAGGCTAC
AGAGAAAGCGTATTTCCTAAAACAGAAGAGGATTTATATTCTTGCGATTTCTTCGATTTG
CATTTAGAAAAAAATATTTACACTGGAGTTATTGCAGGAGGGATGACAGGTTTCATACAC
TTTGTTGACATTTAAAGTTCTACCAATTAAATTTGCTTTTAGGTGCATGGAGATACAATT
TTTGATATCAAATGCTTAAATAGAAATTAGTCATGCTAAGATTACAAAAATATAGTTGTT
AGTGCAAGTAAAGATGGTTCAATTTTTCTTTCTCATTTGGCTAAATAAGAAAAACTTATT
TAGCTTAAAGATTTTTTATCTACTTCTCCTATGTCACAATTTACGTGCATTGACATTGAC
TTAGCTTGCGAAAATATATTTTCCGCTTGTGGAGATGGAACAATTTAAGTTTGGCAGCTA
TCAGAATAAATAAAGAAAATTTTGCTTCTAAAAACTCCTGTGAATAACTTTGTAAAGATT
GAAAAATCTCAATACAATTACTAGGTATAAGCTTAAGAAGATATTATGCATACAGTTCAG
GTCACTTAGTGTAGTTTTTATGGAAAGTATTTACTTTATCTTAATAGCTAAGGATATATT
ACTCTCGGAACATTTATTGAACCATATGTTTACAAAGCTTAGTATCGCATGAGGAAGTTC
GACAAAGACAACACTGGTAAAAATCTGAAGTTTTTTCAAATTACTAATTTTGATTTAGGC
TCGAAAGTAGAAAACTATAACAAAGTCATGCATGTAGACTAAAAAAATGGTCTTGTATGG
ATAGGAAAACAATAGTCAATTTTTTGCTTTGACTTAAAAGATAGAAGGAACTCCGAAATC
GATTACAATTATAGCAAGCCTTTGATTGCTTACAATACTTTTATCAAGGCTAACATTTAG
AAGATATTTTTTAATGAAAATTACTCAGTTCTGTATATTCTTACTGATGCAAAATAGCTA
ATTAAATTCTCATTTATACCTAATAAGTGA


>g8950(gene)
ATGAGCTTTATAGAAAAAATAGAATATGAAATTGAAAAATATTTCCACTCAAGTGGTGTA
AAAGAAGGATTCGAAACTCTTTAAAATGATTTTAAATAATATACTCTTGAGAAAAATACC
TAATTCTAAGATATTAGGAAACACTTAGAGACTCTTTAATAAGAGAGCTTATAAACAGAA
ATTAAGATAGTCACTGAGAATTAAATAAAAGATGCTTGCTTTCTGTATATAGATGGAATT
AGCCTTATAGGAGTAGTGAGTAAAAATTAAATTTATGTCTTCTATTCAAGTGATTCAGCT
TCTTCAAACATAAATTTAATGTCTTAGCATACTATTTAATTTAACATAAGCGATAATCCC
TATTAGTACTAAAGTTATCCAAAGAGCAAGTAAAAAATAGTTAATTTCGTTAAAGGCTAC
AGAGAAAGCGTATTTCCTAAAACAGAAGAGGATTTATATTCTTGCGATTTCTTCGATTTG
CATTTAGAAAAAAATATTTACACTGGAGTTATTGCAGGAGGGATGACAGGTTTCATACAC
TTTGTTGACATTTAAAGTTCTACCAATTAAATTTGCTTTTAGGTGCATGGAGATACAATT
TTTGATATCAAATGCTTAAATAGAAATTAGTCATGCTAAGATTACAAAAATATAGTTGTT
AGTGCAAGTAAAGATGGTTCAATTTTTCTTTCTCATTTGGCTAAATAAGAAAAACTTATT
TAGCTTAAAGATTTTTTATCTACTTCTCCTATGTCACAATTTACGTGCATTGACATTGAC
TTAGCTTGCGAAAATATATTTTCCGCTTGTGGAGATGGAACAATTTAAGTTTGGCAGCTA
TCAGAATAAATAAAGAAAATTTTGCTTCTAAAAACTCCTGTGAATAACTTTGTAAAGATT
GAAAAATCTCAATACAATTACTAGGTATAAGCTTAAGAAGATATTATGCATACAGTTCAG
GTCACTTAGTGTAGTTTTTATGGAAAGTATTTACTTTATCTTAATAGCTAAGGATATATT
ACTCTCGGAACATTTATTGAACCATATGTTTACAAAGCTTAGTATCGCATGAGGAAGTTC
GACAAAGACAACACTGGTGTAAATTTCATATGATTAAAATGAAAATAAAAAATTTTAAAT
ATTTTAATTTATTTTTTTAAAAGAAAAATCTGAAGTTTTTTCAAATTACTAATTTTGATT
TAGGCTCGAAAGTAGAAAACTATAACAAAGTCATGCATGTAGACTAAAAAAATGGTCTTG
TATGGATAGGTATTTACTTCCTCTTAAAGTAAAAATGTTAAGTTTTTAATTAAAATAAAA
TTTAGGAAAACAATAGTCAATTTTTTGCTTTGACTTAAAAGATAGAAGGAACTCCGAAAT
CGATTACAATTATAGCAAGCCTTTGATTGCTTACAATACTTTTATCAAGGCTAACATTTA
GAAGATATTTTTTAATGAAAATTACTCAGTTCTGTATATTCTTACTGATGCAAAATAGCT
AATTAAATTCTCATTTATACCTAATAAGTGA