Identifiers and Description

Gene Model Identifier

TTHERM_01091290

Standard Name

CNJB (CoNJugation-specific B)

Aliases

PreTt01964 | 229.m00029 | 3815.m00151

Description

Conjugation-induced protein; peak expression in meiotic prophase; contains seven CCHC zinc fingers and a repeated glycine-rich motif; associates with Twi1p in DNA elimination

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01091290

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01845 ) Micronucleus: Part of CnjB coding replaced with neo3 Macronucleus: Part of CnjB coding replaced with neo3, completely assorted
  • ( SD01846 ) Micronucleus: Part of CnjB coding replaced with neo3 Macronucleus: Part of CnjB coding replaced with neo3, completely assorted
  • ( SD01847 ) Micronucleus: Part of CnjB coding replaced with neo3 Macronucleus: Part of CnjB coding replaced with neo3, completely assorted
  • ( SD02049 ) Micronucleus: CnjB part of coding replaced with neo3
  • ( SD02050 ) Micronucleus: cnjB part of coding replaced with neo3
  • ( SD02761 ) Micronucleus: Neo3 replaces part of coding Macronucleus: Neo3 replaces part of coding
  • ( SD02762 ) Micronucleus: neo3 replaces part of CnjB coding Macronucleus: neo3 replaces part of CnjB coding
  • ( SD02763 ) Micronucleus: noe3 replaces part of CnjB coding
  • ( SD02764 ) Micronucleus: noe3 replaces part of CnjB coding
  • ( SD02765 ) Macronucleus: Neo3 replaces part of CnjB
  • ( SD02766 ) Macronucleus: Neo3 replaces part of ConjB
  • ( SD02767 ) Macronucleus: Neo3 replaces part of CnjB coding
  • ( SD02768 ) Macronucleus: Neo3 replaces part of CnjB coding
  • ( SD02769 ) Macronucleus: Neo3 replaces part of ConjB
  • ( SD02770 ) Macronucleus: Neo3 replaces part of ConjB
  • ( SD02779 ) Micronucleus: CnjB has part of coding replaced with neo3
  • ( SD02780 ) Micronucleus: CnjB has part of coding replaced with neo3
  • ( SD02795 ) Macronucleus: Ha tagged CnjB with neo3 upstream
  • ( SD02796 ) Macronucleus: Ha tagged CnjB with neo3 upstream
  • ( SD01890 ) Macronucleus: cnjB[5’ neo3,HAn]

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20698.19.997093137033517e-262hypothetical protein (1456 aa)
SGDYNL255C4.000352986427571e-28GIS2 Translational activator f
or mRNAs with internal ribosom
e entry sites; associates with
polysomes and binds to a spec
ific subset of mRNAs; ortholog
of human ZNF9/CNBP, a gene in
volved in myotonic dystrophy t
ype 2
Stentor CoeruleusSteCoe_82774.780892883885469e-25
DictyBaseDDB_G02933287.998763385146868e-21DDB_G0293328 on chromosome: 6
position 2760211 to 2760718
WormBaseWBGene000016019.997019043202629e-21locus:glh-4 ATP-dependent RN
A helicase glh-4 status:Conf
irmed UniProt:O76743 prote
in_id:CCD69784.1
OxytrichaContig16618.0.1.g581.000116773704384e-19Zinc knuckle

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29021213: Noto T, Mochizuki K (2017) Whats, hows and whys of programmed DNA elimination in Tetrahymena. Open biology 7(10):
  2. Ref:19596782: Bednenko J, Noto T, DeSouza LV, Siu KW, Pearlman RE, Mochizuki K, Gorovsky MA (2009) Two GW repeat proteins interact with Tetrahymena thermophila argonaute and promote genome rearrangement. Molecular and cellular biology 29(18):5020-30
  3. Ref:10704239: Larsen LK, Andreasen PH, Dreisig H, Palm L, Nielsen H, Engberg J, Kristiansen K (1999) Cloning and characterization of the gene encoding the highly expressed ribosomal protein l3 of the ciliated protozoan Tetrahymena thermophila. Evidence for differential codon usage in highly expressed genes. Cell biology international 23(8):551-60
  4. Ref:8233798: Taylor FM, Martindale DW (1993) Retroviral-type zinc fingers and glycine-rich repeats in a protein encoded by cnjB, a Tetrahymena gene active during meiosis. Nucleic acids research 21(19):4610-4
  5. Ref:3357771: Martindale DW, Taylor FM (1988) Multiple introns in a conjugation-specific gene from Tetrahymena thermophila. Nucleic acids research 16(5):2189-201
  6. Ref:3005971: Martindale DW, Martindale HM, Bruns PJ (1986) Tetrahymena conjugation-induced genes: structure and organization in macro- and micronuclei. Nucleic acids research 14(3):1341-54

Sequences

>TTHERM_01091290(coding)
ATGGAGATCGAAGTAAATTTACAAATTTCTAACTAGATTGCTGGTGATAGAGAGGTTTAT
TAAAGGACAAAGTAAGAAATGTCAGATTAATATTGCACTACAAAGATTAGTTCTACTGAA
ACCAATGATATTGAAAGTGACTGTGGGATAAGCTAATGCATATCACCAATTGGGAGCGAA
GAGTTTTTAAAAATTAAGTCCGAGTCTCAAGAAAAGCTAAAAGATCCTTAAAGCAAGACC
GCTTACATTATGCTGTAAAAAAGGAGACACGTTTAGCTGGACCAAATAACTGAAATGGAA
GATGTGAGTTCATCTGTGATCTCAGATTCTGATGTTCAGCAGTCCTATGAGTTTTAGAGA
AAAATGATCAAAGTGTCTTCTCAATTTAATGCTTACCTTGATAAAAATATTTACTGTGAT
CAGACAACATCCTACGCTCCAATTGCATAATCAACTCCAGAAGCTGAAGAGTAAAAAAAG
AGCTTTGCTACAAATTTCAACAAAAACTTCAATAGCGAAAAAATGAGCAAAATATTCAGC
TCTTCAAAGGATATAAATCTTGTATAAACAGATGTCCCAGAGAGATTTCAGCTACTCCTT
AATAATTTCGTTGCAGGAAAGTAGATCAACGAAGATGTTATGAAGCATTTAGTAAGATGG
ATATACAGTAATCTTTCTTAAAAAGATGGAACTAATAAAATTAAACTCGAGACTGTTGAA
AACGTGGTTAGATTAGTTGTTTAACAAAAAATGGAAGTTATGACAATTTGGAATAACGAA
AGTAACTTCATTCCTAATATAAGCATCTAAACACTCTGGGATATCTTTAACTTGATGATT
AACTACAAAGATGAAATTTATTTCCCAAGAAGCAGAAATGAAGAAGTTGTAATTGAAATG
TACTCTATCAGATAGATAAGTGATATTATTTAGTTTTTCATGAATGTGGCCTAGAATAGC
AAAGAATTCAATGACATTTAGCAACACCTAAATTACCTAAAGTGCTGTTTTGAGATTTAG
GCTAGAAAAGTTTCTGATTTACTCTAAAGCCATCTGACCAAGATTAATTAAGCCAGAGAG
TACAATATTCCTTAAATTATATATTAATATTTTGATGATTCTTCTTGCTGTGCTGAGATG
CTTTTCCCAAAAATCACAGACCTAGCTCCTTATAAAGAAGAGTATGAAGCTAAGTTCAAT
CCTATCAGATAGCAAGCATCTTAAAAATTGATCAACCAAATGGAGATATACAATGAAGAA
AATCTATTGAGTCATATCTATTAGAACTATACTCAGCTTTCCTAGTAAGAAAGACTTAAT
CTATCAGAATTAATTTAAGACTACATCTGCATTGACTTTCTTTACAATCCTATAATAAAG
AAGTTTATTATTGACAATTATATGAAGTATGCAGTTTTATCAACTTCTCCTTAGGCTCAT
GTAATAGGATTCAACATTTATCATGAGTTTTTTGCTGCCAAAAAAATCATAAAAAAGCCT
CTAAGTGAGATTACGAGCAATGAATTTCTGACTATCCTTTAGGCTAGCTAATAGAACTTA
ATTGAATGCAAAATTCTATTGCCTTGGTAAATAGATCAAGGCGAAGACTTGATTTATAGA
GAGATTAGCTAACATTTTTAACCTCATTTAGCTAGCAAGTCTGAATCACTTAATTCTTAT
ACCTAAAATCTTCTTCAAAGGCTCTTAAAAAACTATTTATATCCATACGCTCAACAATAA
GTATATAAACATCTTGAAAATAAATCCTTAACTGAAGTAAGAGATATCTGTGTTTCTAAA
TTCAAAGAATATATAAGCTATGGTCCATATCTTATTAGAGATAGACAGGATTAACTTGTA
AAGCCTGAAACAATATTGTCTTTTTATGTGCATGAAAGCTCTGGAATTGTTGGAGTTTCA
ATGATAAGCTAGGACGGAAAAGAAATTCACAAGAATTGTTTGGAATATTATTTTAATGCT
GATAAATTAGTATCATAAAAGAGAGAACAAGAAATCAAAAATTTATATGAATTTATTAGA
AACAGATAACCTTATGTCATTATTGTTTCATCAAACTGCTCTAGAGCTCTTGTACTGAAA
TCTAACCTCTATATTCAATTTAAGAACTTATGCAGGAACATTCTTATGTGTGAACAAACT
TTGATGACTTGCTACTTAAACTAGTCTTCTTTTATCCAGTCTCCTAAGGATAAATACATA
TTCTTAGCAAGAAAATAAGCAAAGGCATTTTAGTTTAGACTATTGGAAGTATGCTCACTT
TGGAACTATGAAAGCAATCCATTGCTTGAGATTAAGCTTCATCCTTTCTAGAAAAAGGTT
GACAAAAAGGAATTATAAATTAGATTTGAATAAGTTATTTAAGAAAGAATATGCCAAGAT
GGTTTAGAATTCAAAACACTATTTGATAAAAATCTATCGTTTAAAGATTGCTTACAATTT
ATACCAGGTTTTGGTCCAAGAAAATCTCATTTCTTTATCAGTTAGTTTGAATAAGGCAAA
GATTTCAAAGAAATTACTTCTAGAAAAAAGTGCATTTAGCTCAATTTGATGGGGGAGAAT
CTTATTGTCAACTGTATGGCTTTTATGATGTTCTCTAAATCTGACAATCTCCTAGATCAA
ACTAAAATACCTTACAATCAGTATTTCATTGTGAATCATATTGTTGAAACCATTGACAAA
TGCTAATTGCTTGATTAAACACCTCAACAAACTGCTGTTTAATCAGGTGATATGGTAAAT
TTCTAAGGTTAGTTATAGAAAATGATTTCAAAACCTGAAGTTTGGATGAACAACTTTGAC
ATTAATGATTATAGCAAACTCTTAGAAAAAAATTATCAGAGACCAAATATGGTAATTGTT
TTGTCTAAAATATTAGAAAAATTGTGTGCGTTATCAAATTTAAATGAAAAAATGAAAATG
ATCCCACCTGAATTGAGCTTGAAATAAATTTTTGAGTCAATCTACAACATTCATCCAAAT
TGCATTAGAAAAGGTGCTTAGCTCATGTTAAAATTTAGAGATATTACTGAAAAATACATT
GAATTTACTTCAAAGGATTTCAAAATTAGATGCAGACTAATGAAGTCAGACATTCCTAAT
GGGCTGGCAGTAGAAAAATTCTATTAGAAAAAAAGGAATGCTGAGATTGAACTGATTCTT
GATTCTACCAAAGTGTTTGAAAATCAAAATGAAAATACTCATTAAATCGATGCGATCTTC
GATAACAAAGTAACATTCACTTATCCGGATTACAAAGCTCTAGCAACGCAGATTGTGACA
GAGTTCAAAGACAAAAACCCTTATTTTGGTCAGTTAGATTAAACAGACTTACCTTCCACG
AGAGTAGACTTAAAATCTTAGTTTAATATATTCTCTAAAGAAATGGAAAAGAATCCTCAT
AATGTGATTGATCTTACTGAAAGTACTCCATCTTTCTAAATGCAATAGCAGTGTAAACAA
ATTTAAGAATCTTCTTCTTCTTCTTGGGCTAACTCTTCCGGCTCTTCTACTGTATAAAGT
AATTAAACTTGGGCTAGTAACGATTCTAATCAGGGATGGAATAATAGCAACTAAGCTTAA
AATGAGCAGTCGCTAAGATAAAAAGATAATTCTTAATCAGAATTTAAAAAACCTTTTAAT
AAGAACAACAATTAGAATGATTTCTCAGCAGGTGATAATTCTTCATCATCATGGGGTACC
AGTTAAACGAAACCCTCTTGGGAGTCTAAATAAAGTGAATCTAATAACTTTAACGACTAG
CCTTTGAGAAGTAGAAATTAGTAGTAATAAAACTCAAATTTTAAAAATGATAACAATTCA
TTTGGGAATAAAGAATAGTCCTCAGGATGGAATTAGTCTAATAACAATAATAATAGTGAT
ACGAGTGGATGGGGTAATAGTAGCAATGATTCAGGCTAAAATGCTTCCAAAGAAGATGGA
TGGGGTTCTTCCAATAATAAAACTAATTCTAATGAAGGAGGAGGATGGGGATAAAACATG
AATAAATCTTCTGATAATGATTGGAGTAAATAGGATAATTCAAGTAGCTGGGGTGGTGCT
TAAAATAACAAAGCTCCTACTAATAATTTAGCAAAAAGTAGCTCAAACGAAGGAGGTGGA
TGGGGAAACAACTCATCATCTTCTTCTTCAAATAATTGGGGAGCATCGAAAGACCAAACT
TCTACAAATGAAAGTGGTGGAAATGGCTGGAATTCTTCATAAAATAATGATAACTCAGGA
TGGGGAACTTCAAATACTTCATCATCTAGTAATTTTGGCTAGAATTCTGGTAGAGAAAGA
AACTAAAATGGAGGTAACAAGGGAAAAGGCTGTTTCAAATGTGGCAAAGTTGGTCATATG
GCAAAAGACTGCACAGAACCATAGCAACAAGGCAGAAAATAAAGTGGCGCTTGCTTTAAA
TGCAACCAAGAAGGCCACATGTCTAAAGATTGTCCAAATCAATAATAAAAAAAAAGTGGA
TGTTTTAAATGCGGTGAAGAAGGGCATTTTTCAAAAGATTGCCCCAATCCCCAAAAATAA
TAGCAATAAAAACCTAGAGGGGGCGCATGTTTTAAATGCGGAGAAGAAGGGCACATTTCA
AAAGATTGTCCTAACCCTTAAAAACAGTAGTAAAAAAATACATGTTTTAAATGTAAACAA
GAAGGCCACATTTCCAAAGATTGTCCAAACTCATAAAACTCAGGAGGAAATAAGTGCTTT
AACTGTAATTAAGAAGGTCATATGTCAAAAGACTGTCCTAACCCATCTTAAAAGAAAAAA
GGATGCTTCAATTGTGGAGAAGAAGGTCATTAATCTAGAGAATGCACTAAAGAGAGGAAG
GAGCGTCCACCACGCAATAATAACAACAATAATAATGGTAATTTTAGAGGAAATAAGCAA
TTTGGAGGAGGTGGAAATTCTAATGGAGGCTAATCATGGGGAACTTCCTCTGGCAGTGAT
TGGAATTGTTAAAGTAATGTCTAAGAAAGCACAACTACATCATCTGGAGGATGGGGTAGC
AGTGGATCTGGTAATTAAACTGGAGGAGGATGGGGATCTAATGATAACCAATAATAGCAA
AATGAAAATACAGGAGGAGGCGGGTGGGGATCATCCAATTCAAATTAAACCAATAATGAG
AGTTCTTGGGGTTCAAACAATCAGGCATCTTCAGGTGAAAATTAAAATAACTAGTGGGGT
AACGGAGGAGGATCAGGTGGTTGGTGA


>TTHERM_01091290(protein)
MEIEVNLQISNQIAGDREVYQRTKQEMSDQYCTTKISSTETNDIESDCGISQCISPIGSE
EFLKIKSESQEKLKDPQSKTAYIMLQKRRHVQLDQITEMEDVSSSVISDSDVQQSYEFQR
KMIKVSSQFNAYLDKNIYCDQTTSYAPIAQSTPEAEEQKKSFATNFNKNFNSEKMSKIFS
SSKDINLVQTDVPERFQLLLNNFVAGKQINEDVMKHLVRWIYSNLSQKDGTNKIKLETVE
NVVRLVVQQKMEVMTIWNNESNFIPNISIQTLWDIFNLMINYKDEIYFPRSRNEEVVIEM
YSIRQISDIIQFFMNVAQNSKEFNDIQQHLNYLKCCFEIQARKVSDLLQSHLTKINQARE
YNIPQIIYQYFDDSSCCAEMLFPKITDLAPYKEEYEAKFNPIRQQASQKLINQMEIYNEE
NLLSHIYQNYTQLSQQERLNLSELIQDYICIDFLYNPIIKKFIIDNYMKYAVLSTSPQAH
VIGFNIYHEFFAAKKIIKKPLSEITSNEFLTILQASQQNLIECKILLPWQIDQGEDLIYR
EISQHFQPHLASKSESLNSYTQNLLQRLLKNYLYPYAQQQVYKHLENKSLTEVRDICVSK
FKEYISYGPYLIRDRQDQLVKPETILSFYVHESSGIVGVSMISQDGKEIHKNCLEYYFNA
DKLVSQKREQEIKNLYEFIRNRQPYVIIVSSNCSRALVLKSNLYIQFKNLCRNILMCEQT
LMTCYLNQSSFIQSPKDKYIFLARKQAKAFQFRLLEVCSLWNYESNPLLEIKLHPFQKKV
DKKELQIRFEQVIQERICQDGLEFKTLFDKNLSFKDCLQFIPGFGPRKSHFFISQFEQGK
DFKEITSRKKCIQLNLMGENLIVNCMAFMMFSKSDNLLDQTKIPYNQYFIVNHIVETIDK
CQLLDQTPQQTAVQSGDMVNFQGQLQKMISKPEVWMNNFDINDYSKLLEKNYQRPNMVIV
LSKILEKLCALSNLNEKMKMIPPELSLKQIFESIYNIHPNCIRKGAQLMLKFRDITEKYI
EFTSKDFKIRCRLMKSDIPNGLAVEKFYQKKRNAEIELILDSTKVFENQNENTHQIDAIF
DNKVTFTYPDYKALATQIVTEFKDKNPYFGQLDQTDLPSTRVDLKSQFNIFSKEMEKNPH
NVIDLTESTPSFQMQQQCKQIQESSSSSWANSSGSSTVQSNQTWASNDSNQGWNNSNQAQ
NEQSLRQKDNSQSEFKKPFNKNNNQNDFSAGDNSSSSWGTSQTKPSWESKQSESNNFNDQ
PLRSRNQQQQNSNFKNDNNSFGNKEQSSGWNQSNNNNNSDTSGWGNSSNDSGQNASKEDG
WGSSNNKTNSNEGGGWGQNMNKSSDNDWSKQDNSSSWGGAQNNKAPTNNLAKSSSNEGGG
WGNNSSSSSSNNWGASKDQTSTNESGGNGWNSSQNNDNSGWGTSNTSSSSNFGQNSGRER
NQNGGNKGKGCFKCGKVGHMAKDCTEPQQQGRKQSGACFKCNQEGHMSKDCPNQQQKKSG
CFKCGEEGHFSKDCPNPQKQQQQKPRGGACFKCGEEGHISKDCPNPQKQQQKNTCFKCKQ
EGHISKDCPNSQNSGGNKCFNCNQEGHMSKDCPNPSQKKKGCFNCGEEGHQSRECTKERK
ERPPRNNNNNNNGNFRGNKQFGGGGNSNGGQSWGTSSGSDWNCQSNVQESTTTSSGGWGS
SGSGNQTGGGWGSNDNQQQQNENTGGGGWGSSNSNQTNNESSWGSNNQASSGENQNNQWG
NGGGSGGW


>TTHERM_01091290(gene)
ATGGAGATCGAAGTAAATTTACAAATTTCTAACTAGATTGCTGGTGATAGAGAGGTTTAT
TAAAGGACAAAGTAAGAAATGTCAGATTAATATTGCACTACAAAGATTAGTTCTACTGAA
ACCAATGATATTGAAAGTGACTGTGGGATAAGCTAATGCATATCACCAATTGGGAGCGAA
GAGTTTTTAAAAATTAAGTCCGAGTCTCAAGAAAAGCTAAAAGATCCTTAAAGCAAGACC
GCTTACATTATGCTGGTAAATAATTTCTTTTTTATGGGATAGCTTTTGCTATTATTACAT
CTTTGTTAGTTTATTATGCAAATATAAACACTCCTTTTTAATTTAGTAAAAAAGGAGACA
CGTTTAGCTGGACCAAATAACTGAAATGGAAGATGTGAGTTCATCTGTGATCTCAGATTC
TGATGTTCAGCAGTCCTATGAGTTTTAGAGAAAAATGATCAAAGTGTCTTCTCAATTTAA
TGCTTACCTTGATAAAAGTATTAACATTAAAAATGACTTTAAAATCTCATTTTAATTTCG
AAATCTTAATATTTTAGATATTTACTGTGATCAGACAACATCCTACGCTCCAATTGCATA
ATCAACTCCAGAAGCTGAAGAGGTACCTTATATAATTAATTCATTTATTCATTTATTGGT
TTTTGATGCAAGAGATTCATAATTTTTTTCTAAAATAGTAAAAAAAGAGCTTTGCTACAA
ATTTCAACAAAAACTTCAATAGCGAAAAAATGAGCAAAATATTCAGCTCTTCAAAGGATA
TAAATCTTGTATAAACAGATGTCCCAGAGAGATTTCAGCTACTCCTTAAGTAATTTTGGA
AATTGAGCCTATTTTATTTTTTAAGTTCTACTTTTAAATATAAAAAAAATAAAATTAATA
AATTATTATCAAATAGTAATTTCGTTGCAGGAAAGTAGATCAACGAAGATGTTATGAAGC
ATTTAGTAAGATGGATATACAGTAATCTTTCTTAAAAAGATGGAACTAATAAAATTAAAC
TCGAGACTGTTGAAAACGTGGTTAGATTAGTTGTTTAACAAAAAATGGAAGTTATGACAA
TTTGGAATAACGAAAGTAACTTCATTCCTAATATAAGCATCTAAACACTCTGGGATATCT
TTAACTTGATGATTAACTACAAAGATGAAATTTATTTCCCAAGGTATTTATTTCTGAATA
ATTTATTATTTCTCAAAAGCTTCTTTTTCATGAAAATAATTTTAAATATTAATGAATAAT
TCATTTTTTTAAAATTAGAAGCAGAAATGAAGAAGTTGTAATTGAAATGTACTCTATCAG
ATAGATAAGTGATATTATTTAGTTTTTCATGAATGTGGCCTAGAATAGCAAAGAATTCAA
TGACATTTAGGTAAAAAATAATTTTATTAATTTATCAATTAGACCATAATTTATAAATTT
ATTATAAAATAGCAACACCTAAATTACCTAAAGTGCTGTTTTGAGATTTAGGCTAGAAAA
GTTTCTGATTTACTCTAAAGCCATCTGACCAAGATTAATTAAGCCAGAGAGTACAATATT
CCTTAAATTATATATTAATATTTTGATGATTCTTCTTGCTGTGCTGAGATGCTTTTCCCA
AAAATCACAGACCTAGCTCCTTATAAAGAAGAGTATGAAGCTAAGTTCAATCCTATCAGA
TAGCAAGCATCTTAAAAATTGATCAACCAAATGGAGATATACAATGAAGAAAATCTATTG
AGTCATATCTATTAGAACTATACTCAGCTTTCCTAGTAAGAAAGACTTAATCTATCAGAA
TTAATTTAAGACTACATCTGCATTGACTTTCTTTACAATCCTATAATAAAGAAGTTTATT
ATTGACAATTATATGAAGTATGCAGTTTTATCAACTTCTCCTTAGGCTCATGTAATAGGA
TTCAACATTTATCATGAGTTTTTTGCTGCCAAAAAAATCATAAAAAGTATTATTTATTAT
CTTTTATTTACTTATTAAATAATATTTAAAGCAATAGACTAAGATATATTTTTCTTTTTT
GCTAAAATAAGCAAACCAATTTTTAAAAATTTTCCATTAATTAATTGAATAGAATTTTAA
TACTATCAAGTTAAACTTCTACTTCAATAATATCTGAATGAAAAACAGTCAATTTAATAT
GAAATAATTAGAAAACAAAAAAAACTAAGACTTTTGTTAACTAATAGCCATCTTCTTATG
ATCATAATATATTATTGTTGATAAAAAATAGTTATTTTATATATTTATACTATATAGAAA
ATTATAATAATTCATCATGACTTTATCATTAATTTTTTTTTTAAAAAAAGAGCCTCTAAG
TGAGATTACGAGCAATGAATTTCTGACTATCCTTTAGGCTAGCTAATAGAACTTAATTGA
ATGCAAAATTCTATTGCCTTGGTAAATAGATCAAGGCGAAGACTTGATTTATAGAGAGAT
TAGCTAACATTTTTAACCTCATTTAGCTAGCAAGTCTGAATCACTTAATTCTTATACCTA
AAATCTTCTTCAAAGGCTCTTAAAAAACTATTTGTAATTAATTTAATTGAAATATTTTAG
ATAAAAATAATATTTTTAATGGTTTATAAAAAAATAACTATTAGATATCCATACGCTCAA
CAATAAGTATATAAACATCTTGAAAATAAATCCTTAACTGAAGTAAGAGATATCTGTGTT
TCTAAATTCAAAGAATATATAAGCTATGTAATAAAATATTTATTTATTAAACAATCCATT
CAATATTTTAAATAAAATAATTTCCAACTGAGTAAAAAAATATGAATAAAATATTTTTTT
TGCTTAAATAAAAAATTTATCTTGAGTGATTAAAAAAATAAAATTTGAATTAATGATATA
GATGAAAACTTACTTATTTCCCTATACAATTAATTATTAAATCAACTTTATCAGTTTTTG
AATTACTTTAATTTGTAATATTTCTGGTAGTTTAATTAATTGCTTAAGTCCTACCCCAAA
GATTTTATTAAATTTAAAGCAGCTTCACGTTTTGAAAAATTATTGCATGAAATTTTTTAT
TATCCCAAATTATTACATATTTTTACAAATAAATAGAAGATAAATTTCTTTGCCCCTGTA
ATTTATTTTAGTGGTAAGAGATTCTATTTGAAAATTAAATAAATTGTTAATATTTAAAAA
AGTAAGTTTCTTGAATGTTAATTTGATTGTATTTTTCACTCAATCACTCAACAATAAAAT
AAATTAATTTTTTTAAAAATGTAAGATAGATGCTTTTTTTTTTTGTCAAATTATGATGAC
GTAACATCAATTAAAAAAAACAATAATTTTTTTCTTTTAAGTTTCTCTTAAAAATCCTAT
ATATTTATACACAAGACAACTCTGATTTTGAATTATTTAATAGGGTCCATATCTTATTAG
AGATAGACAGGATTAACTTGTAAAGCCTGAAACAATATTGTCTTTTTATGTGCATGAAAG
CTCTGGAATTGTTGGAGTTTCAATGATAAGCTAGGACGGAAAAGAAATTCACAAGAATTG
TTTGGAATATTATTTTAATGCTGATAAATTAGTATCATAAAAGAGAGAACAAGAAATCAA
AAATTTATATGAATTTATTAGAAACAGATAACCTTATGTCATTATTGTTTCATCAAACTG
CTCTAGAGCTCTTGTACTGAAATCTAACCTCTATATTCAATTTAAGGTAAAAATTAATCA
ATGAATTAATTAGTAAATTTAGAGTTGATTGCAATGTTTAATATTTTTTAGTAAATTTTA
AGAAAATTATTGAATTAACTCTAATAACAAAGCAAATAGCTAAATAAAAAGCTAAAAAAT
AATTAAATAAATAAATGATTTTTATTCATCAAAATATTAGAACTTATGCAGGAACATTCT
TATGTGTGAACAAACTTTGATGACTTGCTACTTAAACTAGTCTTCTTTTATCCAGTCTCC
TAAGGATAAATACATATTCTTAGCAAGAAAATAAGCAAAGGCATTTTAGTTTAGACTATT
GGAAGTATGCTCACTTTGGAACTATGAAAGCAATCCATTGCTTGAGATTAAGCTTCATCC
TTTCTAGGTATAAATTAGAATTTACTAATTCCCAATTTTTTTTACTTTTTATTGCAGCAT
TTTTCTTGTGTCATTTATTTCAAAATATATAATAAAGGGATTATTTTAATCTTCATCTAA
TCTATTTTAAATATTAAGAAAAAGGTTGACAAAAAGGAATTATAAATTAGATTTGAATAA
GTTATTTAAGAAAGAATATGCCAAGATGGTTTAGAATTCAAAACACTATTTGATAAAAAT
CTATCGTTTAAAGATTGCTTACAATTTATACCAGGTTTTGGTCCAAGAAAATCTCATTTC
TTTATCAGTTAGTTTGAATAAGGCAAAGATTTCAAAGAAATTACTTCTAGAAAAAAGTGC
ATTTAGCTCAATTTGATGGGGGAGAATCTTATTGTCAACTGTATGGCTTTTATGATGTTC
TCTAAATCTGACAATCTCCTAGATCAAACTAAAATACCTTACAATCGTAAATCTTAAATC
AATCTATTACTTCATGTTTAAAAAATACTTTAAATTTTACTTTGTTATTTTTTCAAATTC
CTACTTACTCTATCTTAATAAATTTGAATAGATAGATACTTAAGCAGTAATTTTTAATTT
TAAGTTAATTGCTTTCTTTCATTCTTTCTTTCTTTAAAATTATTTTTATGAGTTAAAATT
TATAAAAATTAATAAAGAGTATTTCATTGTGAATCATATTGTTGAAACCATTGACAAATG
CTAATTGCTTGATTAAACACCTCAACAAACTGCTGTTTAATCAGGTGATATGGTAAATTT
CTAAGGTTAGTTATAGAAAATGATTTCAAAACCTGAAGTTTGGATGAACAACTTTGACAT
TAATGATTATAGCAAACTCTTAGAAAAAAATTATCAGAGACCAAATATGGTAATTGTTTT
GTCTAAAATATTAGAAAAATTGTGTGCGTTATCAAATTTAAATGAAAAAATGAAAATGAT
CCCACCTGAATTGAGCTTGAAATAAATTTTTGAGTCAATCTACAACATTCATCCAAATTG
CATTAGAAAAGGTGCTTAGCTCATGTTAAAATTTAGAGATATTACTGAAAAATACATTGA
ATTTACTTCAAAGGATTTCAAAATTAGATGCAGACTAATGAAGTAATTAATTTATATTTT
TATTTTTAACATACATACATACCAACCTTATTTAAACACATTTTTCTTAATGAAGGTCAG
ACATTCCTAATGGGCTGGCAGTAGAAAAATTCTATTAGAAAAAAAGGAATGCTGAGATTG
AACTGATTCTTGATTCTACCAAAGTGTTTGAAAATCAAAATGAAAATACTCATTAAATCG
ATGCGATCTTCGATAACAAAGTAACATTCACTTATCCGGATTACAAAGCTCTAGCAACGC
AGATTGTGACAGAGTTCAAAGACAAAAACCCTTATTTTGGTCAGTTAGATTAAACAGACT
TACCTTCCACGAGAGTAGACTTAAAATCTTAGTTTAATATATTCTCTAAAGAAATGGAAA
AGAATCCTCATAATGTGATTGATCTTACTGAAAGTACTCCATCTTTCTAAATGCAATAGC
AGTGTAAACAAATTTAAGAATCTTCTTCTTCTTCTTGGGCTAACTCTTCCGGCTCTTCTA
CTGTATAAAGTAATTAAACTTGGGCTAGTAACGATTCTAATCAGGGATGGAATAATAGCA
ACTAAGCTTAAAATGAGCAGTCGCTAAGATAAAAAGATAATTCTTAATCAGAATTTAAAA
AACCTTTTAATAAGAACAACAATTAGAATGATTTCTCAGCAGGTGATAATTCTTCATCAT
CATGGGGTACCAGTTAAACGAAACCCTCTTGGGAGTCTAAATAAAGTGAATCTAATAACT
TTAACGACTAGCCTTTGAGAAGTAGAAATTAGTAGTAATAAAACTCAAATTTTAAAAATG
ATAACAATTCATTTGGGAATAAAGAATAGTCCTCAGGATGGAATTAGTCTAATAACAATA
ATAATAGTGATACGAGTGGATGGGGTAATAGTAGCAATGATTCAGGCTAAAATGCTTCCA
AAGAAGATGGATGGGGTTCTTCCAATAATAAAACTAATTCTAATGAAGGAGGAGGATGGG
GATAAAACATGAATAAATCTTCTGATAATGATTGGAGTAAATAGGATAATTCAAGTAGCT
GGGGTGGTGCTTAAAATAACAAAGCTCCTACTAATAATTTAGCAAAAAGTAGCTCAAACG
AAGGAGGTGGATGGGGAAACAACTCATCATCTTCTTCTTCAAATAATTGGGGAGCATCGA
AAGACCAAACTTCTACAAATGAAAGTGGTGGAAATGGCTGGAATTCTTCATAAAATAATG
ATAACTCAGGATGGGGAACTTCAAATACTTCATCATCTAGTAATTTTGGCTAGAATTCTG
GTAGAGAAAGAAACTAAAATGGAGGTAACAAGGGAAAAGGCTGTTTCAAATGTGGCAAAG
TTGGTCATATGGCAAAAGACTGCACAGAACCATAGCAACAAGGCAGAAAATAAAGTGGCG
CTTGCTTTAAATGCAACCAAGAAGGCCACATGTCTAAAGATTGTCCAAATCAATAATAAA
AAAAAAGTGGATGTTTTAAATGCGGTGAAGAAGGGCATTTTTCAAAAGATTGCCCCAATC
CCCAAAAATAATAGCAATAAAAACCTAGAGGGGGCGCATGTTTTAAATGCGGAGAAGAAG
GGCACATTTCAAAAGATTGTCCTAACCCTTAAAAACAGTAGTAAAAAAATACATGTTTTA
AATGTAAACAAGAAGGCCACATTTCCAAAGATTGTCCAAACTCATAAAACTCAGGAGGAA
ATAAGTGCTTTAACTGTAATTAAGAAGGTCATATGTCAAAAGACTGTCCTAACCCATCTT
AAAAGAAAAAAGGATGCTTCAATTGTGGAGAAGAAGGTCATTAATCTAGAGAATGCACTA
AAGAGAGGAAGGAGCGTCCACCACGCAATAATAACAACAATAATAATGGTAATTTTAGAG
GAAATAAGCAATTTGGAGGAGGTGGAAATTCTAATGGAGGCTAATCATGGGGAACTTCCT
CTGGCAGTGATTGGAATTGTTAAAGTAATGTCTAAGAAAGCACAACTACATCATCTGGAG
GATGGGGTAGCAGTGGATCTGGTAATTAAACTGGAGGAGGATGGGGATCTAATGATAACC
AATAATAGCAAAATGAAAATACAGGAGGAGGCGGGTGGGGATCATCCAATTCAAATTAAA
CCAATAATGAGAGTTCTTGGGGTTCAAACAATCAGGCATCTTCAGGTGAAAATTAAAATA
ACTAGTGGGGTAACGGAGGAGGATCAGGTGGTTGGTGA