Identifiers and Description

Gene Model Identifier

TTHERM_00049220

Standard Name

ZHP3 (Zip3 Homologous Protein 3)

Aliases

PreTt11301 | 3.m01752 | 3824.m03061 | COI20

Description

hypothetical protein; Zip3/RNF212/HEI10 family protein- also known as Coi20p; role in crossover formation in meiosis- independent of synaptonemal complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 23.4%

TetraMine Data

TTHERM_00049220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01635.16.0025840010353464e-108hypothetical protein (399 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28100637: Shodhan A, Kataoka K, Mochizuki K, Novatchkova M, Loidl J (2017) A Zip3-like protein plays a role in crossover formation in the SC-less meiosis of the protist Tetrahymena. Molecular biology of the cell 28(6):825-833
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  3. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_00049220(coding)
ATGACCTTTATTATCAAAAACTGTCTTGGAAAACTTTGTCTTAGACATTTATTAATGAAA
GAAGATTCTTATAAATCTCTATGCACAGCTTGCTTTTAATAAAAGGCTGCTTATTACTTA
TGTTGTAGATGTATCTTTTGCAAAGAATGTATATAGAGATGGAAAGATAGTTATAAAACA
ATTGAAAATTCAGCAGATGTCATTTGTGGATTTTGCAATAAATAAACTGACCCTAAAATA
AACAGCTTTTAGGATATGAAATAAGCATAATCATTTGCTTTTTTATTTGCAGATCCTGAG
ACTCTATTTGAAAGACAAATTGAAATAATCAAATTCTAGAGAAAACAAAGTTTGAAGTAT
ATTTAATACTTACAGGACCAGTTAAATATAAACAAATAAGAGCTTTCCTTGATTTATGAA
AGCTTTCCTGAGATAAAAAATGAAATATCAGTGAGGAGAATGAGCAACACTTTAAATAAT
GAAGATGATATCAGAAAAATTTCTAGGAGTTGTGTAAACTTTAAACAAGTTAATGAAAAT
ATACAAAATGATTCATTTTAGTAAAATTAATTGTAAAACCAAGTTAGAGAGTCTAATAAA
ATAAATTAATTTCAAGTAAATCCTTAATATAATTAGTAGTATAATTTATAATAAAATTTA
CCCTACCAGAAAGACTATTAAACAAACGAACCTTAACAATAATAATAATATTAATAGTAG
AAGTAGCTCATGATAAATAAATAAAATAACCAAATAAATAAAAATAATCTGAACACAATA
GGGTATTAAAATAAACCAATTATGTAATAGAGGAACGAGTATGTGACTCCTATTCAAAAC
AACATTAGTAATTTCAATATTAATAATAAGATTAGTAATCTGAATAATTCAGGTGGGTTG
TCATATTAAGATTACATGCAAAAATAACAAAATTTAATTAACTACAATCAAATAGTCCAA
GGAAATTCAATTTAAAGAAAAGATTCATAATAAAGAAACACTTTTAATTAAATAACTTAA
CAATATTAGTTTTAAAAAGAAATTGAAGATTCAAGCAATCCTTACATTAATCATTAACAA
GGAAAACAAAATGATTTTACTTAAGTAAGAAACAAGATGCAGCCATCTAAAGAAAACATG
AATTTAGTTTTGAATTAAGCTTACACATCTTATAATTAAAATTAAAAACCTTAATTAAGC
TATCAGCAAAAATATATTGACTAATACAATCCAAAATTAAGCAAATGA


>TTHERM_00049220(protein)
MTFIIKNCLGKLCLRHLLMKEDSYKSLCTACFQQKAAYYLCCRCIFCKECIQRWKDSYKT
IENSADVICGFCNKQTDPKINSFQDMKQAQSFAFLFADPETLFERQIEIIKFQRKQSLKY
IQYLQDQLNINKQELSLIYESFPEIKNEISVRRMSNTLNNEDDIRKISRSCVNFKQVNEN
IQNDSFQQNQLQNQVRESNKINQFQVNPQYNQQYNLQQNLPYQKDYQTNEPQQQQQYQQQ
KQLMINKQNNQINKNNLNTIGYQNKPIMQQRNEYVTPIQNNISNFNINNKISNLNNSGGL
SYQDYMQKQQNLINYNQIVQGNSIQRKDSQQRNTFNQITQQYQFQKEIEDSSNPYINHQQ
GKQNDFTQVRNKMQPSKENMNLVLNQAYTSYNQNQKPQLSYQQKYIDQYNPKLSK


>TTHERM_00049220(gene)
ATGACCTTTATTATCAAAAACTGTCTTGGGTAACTCTTCAAAAAAAAAATATTTAATTGA
TTAAATTTTTAACATATAAAAGTGTTTTTGATGATTAAAGACATTATTTTTAAAAGTTTT
TTTACAACTTTGTTGAAATATTATGCTTTTTTATATGATAAAAATTTTTTAAGATGAATA
TCATCAATTATTTCTAAAAATTAAATCAATCAAATTTTCATTAAATTTTATAATGTAACT
CTTAATTTTTAAGCCTTAAAATCTAAAGATGATTTAGAATATTTTTTATAATTTTATTAG
AATATTTTTTAAAATTTTGTTTATCTTTTATATTAATTAAAAACAATAAATAAAATTAGT
TTAAGAGGATTGGATATTTTTTAAGAATAATTATTACTAAAAACTTAATCCAAACAAACC
TAAATGAGAGAATTTGTTTATTAATAATATTTTAAATCAGCTTACTTGTATTTTGGATTA
TAAAATTAATGATATTAACTGTTTTAGATTTTCTAATTTTGACTTATTTTTAGTATGAAT
AAAGTTTATAAACAAAGTGAATTTAAGTAAAAGTTTTAATTAAAAATGAGACATGAATAA
AATTAAAGTTTGTTTCAAATGTAATTTATTTATATAAATTATTTTTAAAATTTTAAATAG
AAAACTTTGTCTTAGACATTTATTAATGAAAGAAGATTCTTATAAATCTCTATGCACAGC
TTGCTTTTGTAATTTTCTAGATTATTAAATATTATTTTAAAAGGTAAAAATTATATATAG
AATAAAAGGCTGCTTATTACTTATGTTGTAGATGTATCTTTTGCAAAGAATGTATATAGA
GATGGAAAGATAGTTATAAAACAATTGAAAATTCAGCAGATGTCATTTGTGGATTTTGCA
ATAAATAAACTGACCCTAAAATAAACAGCTTTTAGGATATGAAATAAGCATAATCATTTG
CTTTTTTATTTGCAGATCCTGAGACTCTATTTGAAAGACAAATTGAAATAATCAAAGTAA
TATTTTTCATGTAAAATAAATGGCTAAACTTTTTCATAAAAAAGTTCTAGAGAAAACAAA
GTTTGAAGTATATTTAATACTTACAGGACCAGTTAAATATAAACAAATAAGAGCTTTCCT
TGATTTATGAAAGCTTTCCTGAGATAAAAAATGAAATATCAGTGAGGAGAATGAGCAACA
CTTTAAATAATGAAGATGATATCAGAAAAATTTCTAGGAGTTGTGTAAACTTTAAACAAG
TTAATGAAAATATACAAAATGATTCATTTTAGTAAAATTAATTGTAAAACCAAGTTAGAG
AGTCTAATAAAATAAATTAATTTCAAGTAAATCCTTAATATAATTAGTAGTATAATTTAT
AATAAAATTTACCCTACCAGAAAGACTATTAAACAAACGAACCTTAACAATAATAATAAT
ATTAATAGTAGAAGTAGCTCATGATAAATAAATAAAATAACCAAATAAATAAAAATAATC
TGAACACAATAGGGTATTAAAATAAACCAATTATGTAATAGAGGAACGAGTATGTGACTC
CTATTCAAAACAACATTAGTAATTTCAATATTAATAATAAGATTAGTAATCTGAATAATT
CAGGTGGGTTGTCATATTAAGATTACATGCAAAAATAACAAAATTTAATTAACTACAATC
AAATAGTCCAAGGAAATTCAATTTAAAGAAAAGATTCATAATAAAGAAACACTTTTAATT
AAATAACTTAACAATATTAGTTTTAAAAAGAAATTGAAGATTCAAGCAATCCTTACATTA
ATCATTAACAAGGAAAACAAAATGATTTTACTTAAGTAAGAAACAAGATGCAGCCATCTA
AAGAAAACATGAATTTAGTTTTGAATTAAGCTTACACATCTTATAATTAAAATTAAAAAC
CTTAATTAAGCTATCAGCAAAAATATATTGACTAATACAATCCAAAATTAAGCAAATGA