Identifiers and Description

Gene Model Identifier

TTHERM_00531890

Standard Name

ZFR3 (zinc finger-related protein 3)

Aliases

PreTt19849 | 68.m00138 | 3830.m00503 | COI9

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00097 ) zinc finger, C3HC4 type (RING

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00531890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11798.17.000463540624081e-176hypothetical protein (862 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77
  2. Ref:23251712: Xu J, Tian H, Wang W, Liang A (2012) The zinc finger protein Zfr1p is localized specifically to conjugation junction and required for sexual development in Tetrahymena thermophila. PloS one 7(12):e52799

Sequences

>TTHERM_00531890(coding)
ATGCAACACTTTGAAGAGACATAATCTTCAGAAAAACTGAGCCCAAATACAAGTAACTTG
TAGCCTCGTCAAGAGAAGCTATTGTGTTTTTGTGGAAGAGTTATCATAGAAAAACCTGTT
ACTTTACCTTGTGGTCATTAATACCACTTTAAATGTGCTAGAGATTATGTTTTTAATGTC
TAAACATAAATATAGAGTATTGAAGATATGATCTGCCCCTTTTGCTAAAGTAATAACAAT
AATTCCTAATGTGATAATTTTTAAACTAGTCACTACGTACTATAAGAGGAATTAGATGAA
GAGAATGAAAACTTTATTAATTTGAAATTTAAAAAGATAAATACTTAGCATAACAATAAC
TAAACTCCACTAAGCAATTAAACAAATACAAGCTTGAATTAGAATTCTTAAAATACCTCT
AATGATTAAAGTTTCAAATACTAAACTCCCAACATGAATAAATATAGCAAAAGGTCTAGA
TATTCTAATAATGATGACTCTAACAGCACAAATAAACAAAACAACTTAAATACATTTTTA
ATTAGTCCAGCCTAGGCATCATTCAAAAGTACTTAAGAGCGTGTGCCCTTTACAGATATA
ACTGCATAAATTAACAAAAAATCTCCTTAAACTTAATATAATTCAATAAAGAATAAAATT
TGTTTTGAAAATGTGAATTAGGATACAAGTAAAGAAATGTAGCCAAGAGAAATAATTCAA
AACAATTAATTTAGCTTTTATGAAAGCAAAATTTAAGAGTAAAAAGCTTAAAATATTAAC
CAACCTTTCGCTATTACAAATTCAGAATCCCAAAAGAATATTTATCAAAAAAATAGATAT
GGAAATTACATCTAAGTTTTGGGAGAAAGGATTATTAAGAAAAGTTTAGAAATAAAGAAT
AATTAATATTCTTCAATATCTGCTTCTTCTTCGTCATCCTCATCATTTTCTTCTTAATTA
TAAGGAAATCGAAATTCAATCTAAAAAATAAATCTCAGCTGTTCAGATATTATGTAAAAT
GTGTCTTTATCAGATTCAAGTTTAATTTCAAATAGCTTTTATTAGCAATACCCTTCTATC
TTTCCAAATAATGCTACTTCAAATATGTTTACCAGAATGAAATAAATTTTGCATTCATCA
TAAGTAATGAATTACTCATTTAATAATTCTATGGCTTCTATAGGTAGTGATAAAGAAAAT
GTTAGGAACATAACAACGAGAAGAGCAAGAAATAACGTTTTGTAAGCTTCATTTTATGAA
GGAGTTTCTTATATGTGCCCTAACAGCTTATACACTAAATTTAATAAAAAAGAGCAAGAA
AAGACTCTTTAAAATGAAATTTTTAAACCCGAAAAATAACTCTCAGATATTGAAGAAAGA
GATAAAGAATGTTTAGCATACCCATTTTGTATTGAGCTATCTAATTTATTTAATTCGAAT
GAGAATAATAATTTCAAGAATACCCAAGATTTTCTTATTCTGTTTGTACATGACAAATTA
ACAAGTGAGTAAAGATACCTAGCTATGAAAAGTCTTTACACATGTCTTGATACCTATGAT
ACTTTATCACTCTCTTGGATAAATTCCACTACAAATAAAGTATTTAAGTCTTCATCTGAT
TACTTTTTTGGAAGAGAAATGGATGAGTTAGTATCAAGCGAATTTATGAGGCTTTAAGCT
AACAAACAGTCTGAAATTATTTTAGAAGCTGACTAGAAACCAGAACTTACTCGCTAAAAA
GAGAATTATGTTTTAGATAGCGATGAAAAATCTGAAATCAAGAAGAAAAATCTAAGCCTA
TTTGTGCAAGAATAATTCAAACTGTTAAAGATCAAGAGAATGATTTAACATTTTGTATTA
ATATAAGCAGAGGATGTTGAGTTAAATTTTTTGAAAGAGCTAGATGGCATAAAAAATGTT
ATGACAAGTGTTATCAAAATCCCATCAAACATTTTAAATCTCTCAAATAGTTTGGAATTC
AGTGAAAGTTGTAAAAATCTCTTTAACAATCAAATTGATGGAACAAGGCGAACAAATATT
AAGAATTTAAATATAGCAATTGAGATTAATCCTTATTTAAATAATCTACTAGATCTATCC
CTTGTTAATAAAGAAGAGTTTTCAGCTAAAGTAAAAAAAACTACTCTAAGGAATGTAAAG
TCCTCTTCAAAAAGCAGTGAAAATCTAGTAACTGATGAAGAGCTAGAAAATTAAATGGAG
AAAGATAAACATAACGAAGTAGATTAATAATTGAGAGAAAACTCCAACTTTCCTGAATTA
AGCACAATATTTGAGGTTGATATTGACTATTTAAAAAAAGATAGAGAATTATTACTTTTT
GAAATTACATTTAGCAAGGACATAAACCCAAGTTATCAGAGCGCTCAGCTTTTTAATTGT
TCCATTTAATACGATTTTATTTATGTTGAATTACCAAATAACCAAATTGAATATTCGGTA
AACTCGCAAACAGGTGAGTTTGAATTATCTGATTCTTAAAATTTTATGAATTTTCCTCCT
ATGTTTTAAGACATTTCACAAAACTTAAAAAATCTATATCTTCTTTTTGAGTGGCATAAA
GACACAAATCATCTGCGTTATAATAGGAGAGTAATGTATTCATTTTGGGAGGAGGAAGTA
AAACAATCTAATTTATAACAAGTAATCTACGATAAATATAAACAGATTTTTGACTCAATT
GCTCAAAAAAAATAGAACTAAGATTTTGAAGAATATAAAATGTTCACAGAATATTATCAA
AAGCTATTGAAACTAAATCAAAATTGA


>TTHERM_00531890(protein)
MQHFEETQSSEKLSPNTSNLQPRQEKLLCFCGRVIIEKPVTLPCGHQYHFKCARDYVFNV
QTQIQSIEDMICPFCQSNNNNSQCDNFQTSHYVLQEELDEENENFINLKFKKINTQHNNN
QTPLSNQTNTSLNQNSQNTSNDQSFKYQTPNMNKYSKRSRYSNNDDSNSTNKQNNLNTFL
ISPAQASFKSTQERVPFTDITAQINKKSPQTQYNSIKNKICFENVNQDTSKEMQPREIIQ
NNQFSFYESKIQEQKAQNINQPFAITNSESQKNIYQKNRYGNYIQVLGERIIKKSLEIKN
NQYSSISASSSSSSSFSSQLQGNRNSIQKINLSCSDIMQNVSLSDSSLISNSFYQQYPSI
FPNNATSNMFTRMKQILHSSQVMNYSFNNSMASIGSDKENVRNITTRRARNNVLQASFYE
GVSYMCPNSLYTKFNKKEQEKTLQNEIFKPEKQLSDIEERDKECLAYPFCIELSNLFNSN
ENNNFKNTQDFLILFVHDKLTSEQRYLAMKSLYTCLDTYDTLSLSWINSTTNKVFKSSSD
YFFGREMDELVSSEFMRLQANKQSEIILEADQKPELTRQKENYVLDSDEKSEIKKKNLSL
FVQEQFKLLKIKRMIQHFVLIQAEDVELNFLKELDGIKNVMTSVIKIPSNILNLSNSLEF
SESCKNLFNNQIDGTRRTNIKNLNIAIEINPYLNNLLDLSLVNKEEFSAKVKKTTLRNVK
SSSKSSENLVTDEELENQMEKDKHNEVDQQLRENSNFPELSTIFEVDIDYLKKDRELLLF
EITFSKDINPSYQSAQLFNCSIQYDFIYVELPNNQIEYSVNSQTGEFELSDSQNFMNFPP
MFQDISQNLKNLYLLFEWHKDTNHLRYNRRVMYSFWEEEVKQSNLQQVIYDKYKQIFDSI
AQKKQNQDFEEYKMFTEYYQKLLKLNQN


>TTHERM_00531890(gene)
ATGCAACACTTTGAAGAGACATAATCTTCAGAAAAACTGAGCCCAAATACAAGTAACTTG
TAGCCTCGTCAAGAGAAGCTATTGTGTTTTTGTGGAAGAGTTATCATAGAAAAACCTGTT
ACTTTACCTTGTGGTCATTAATACCACTTTAAATGTGCTAGAGATTATGTTTTTAATGTC
TAAACATAAATATAGAGTATTGAAGATATGATCTGCCCCTTTTGCTAAAGTAATAACAAT
AATTCCTAATGTGATAATTTTTAAACTAGTCACTACGTACTATAAGAGGAATTAGATGAA
GAGAATGAAAACTTTATTAATTTGAAATTTAAAAAGATAAATACTTAGCATAACAATAAC
TAAACTCCACTAAGCAATTAAACAAATACAAGCTTGAATTAGAATTCTTAAAATACCTCT
AATGATTAAAGTTTCAAATACTAAACTCCCAACATGAATAAATATAGCAAAAGGTCTAGA
TATTCTAATAATGATGACTCTAACAGCACAAATAAACAAAACAACTTAAATACATTTTTA
ATTAGTCCAGCCTAGGCATCATTCAAAAGTACTTAAGAGCGTGTGCCCTTTACAGATATA
ACTGCATAAATTAACAAAAAATCTCCTTAAACTTAATATAATTCAATAAAGAATAAAATT
TGTTTTGGTAATTTTTAAAAATTTTTATTGATTTTTTATTTTTATTTTTTCAAAAATTAA
CAAAAGAAAATGTGAATTAGGATACAAGTAAAGAAATGTAGCCAAGAGAAATAATTCAAA
ACAATTAATTTAGCTTTTATGAAAGCAAAATTTAAGAGTAAAAAGCTTAAAATATTAACC
AACCTTTCGCTATTACAAATTCAGAATCCCAAAAGAATATTTATCAAAAAAATAGATATG
GAAATTACATCTAAGTTTTGGGAGAAAGGATTATTAAGAAAAGTTTAGAAATAAAGAATA
ATTAATATTCTTCAATATCTGCTTCTTCTTCGTCATCCTCATCATTTTCTTCTTAATTAT
AAGGAAATCGAAATTCAATCTAAAAAATAAATCTCAGCTGTTCAGATATTATGTAAAATG
TGTCTTTATCAGATTCAAGTTTAATTTCAAATAGCTTTTATTAGCAATACCCTTCTATCT
TTCCAAATAATGCTACTTCAAATATGTTTACCAGAATGAAATAAATTTTGCATTCATCAT
AAGTAATGAATTACTCATTTAATAATTCTATGGCTTCTATAGGTAGTGATAAAGAAAATG
TTAGGAACATAACAACGAGAAGAGCAAGAAATAACGTTTTGTAAGCTTCATTTTATGAAG
GAGTTTCTTATATGTGCCCTAACAGCTTATACACTAAATTTAATAAAAAAGAGCAAGAAA
AGACTCTTTAAAATGAAATTTTTAAACCCGAAAAATAACTCTCAGATATTGAAGAAAGAG
ATAAAGAATGTTTAGCATACCCATTTTGTATTGAGCTATCTAATTTATTTAATTCGAATG
AGAATAATAATTTCAAGAATACCCAAGATTTTCTTATTCTGTTTGTACATGACAAATTAA
CAAGTGAGTAAAGATACCTAGCTATGAAAAGTCTTTACACATGTCTTGATACCTATGATA
CTTTATCACTCTCTTGGATAAATTCCACTACAAATAAAGTATTTAAGTCTTCATCTGATT
ACTTTTTTGGAAGAGAAATGGATGAGTTAGTATCAAGCGAATTTATGAGGCTTTAAGCTA
ACAAACAGTCTGAAATTATTTTAGAAGCTGACTAGAAACCAGAACTTACTCGCTAAAAAG
AGAATTATGTTTTAGATAGCGATGAAAAATCTGAAATCAAGAAGAAAAATCTAAGCCTAT
TTGTGCAAGAATAATTCAAACTGTTAAAGATCAAGAGAATGATTTAACATTTTGTATTAA
TATAAGCAGAGGATGTTGAGTTAAATTTTTTGAAAGAGCTAGATGGCATAAAAAATGTTA
TGACAAGTGTTATCAAAATCCCATCAAACATTTTAAATCTCTCAAATAGTTTGGAATTCA
GTGAAAGTTGTAAAAATCTCTTTAACAATCAAATTGATGGAACAAGGCGAACAAATATTA
AGAATTTAAATATAGCAATTGAGATTAATCCTTATTTAAATAATCTACTAGATCTATCCC
TTGTTAATAAAGAAGAGTTTTCAGCTAAAGTAAAAAAAACTACTCTAAGGAATGTAAAGT
CCTCTTCAAAAAGCAGTGAAAATCTAGTAACTGATGAAGAGCTAGAAAATTAAATGGAGA
AAGATAAACATAACGAAGTAGATTAATAATTGAGAGAAAACTCCAACTTTCCTGAATTAA
GCACAATATTTGAGGTTGATATTGACTATTTAAAAAAAGATAGAGAATTATTACTTTTTG
AAATTACATTTAGCAAGGACATAAACCCAAGTTATCAGAGCGCTCAGCTTTTTAATTGTT
CCATTTAATACGATTTTATTTATGTTGAATTACCAAATAACCAAATTGAATATTCGGTAA
ACTCGCAAACAGGTGAGTTTGAATTATCTGATTCTTAAAATTTTATGAATTTTCCTCCTA
TGTTTTAAGACATTTCACAAAACTTAAAAAATCTATATCTTCTTTTTGAGTGGCATAAAG
ACACAAATCATCTGCGTTATAATAGGAGAGTAATGTATTCATTTTGGGAGGAGGAAGTAA
AACAATCTAATTTATAACAAGTAATCTACGATAAATATAAACAGATTTTTGACTCAATTG
CTCAAAAAAAATAGAACTAAGATTTTGAAGAATATAAAATGTTCACAGAATATTATCAAA
AGCTATTGAAACTAAATCAAAATTGA