Identifiers and Description

Gene Model Identifier

TTHERM_01285910

Standard Name

ZFR1 (zinc finger-related protein 1)

Aliases

PreTt19421 | 308.m00019

Description

Zinc finger protein localizes to conjugation junction and is required for sexual development

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00643 ) B-box zinc finger
  • ( PF04508 ) Viral A-type inclusion protein repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_01285910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01442.19.004486704249587e-32hypothetical protein (307 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:23251712: Xu J, Tian H, Wang W, Liang A (2012) The zinc finger protein Zfr1p is localized specifically to conjugation junction and required for sexual development in Tetrahymena thermophila. PloS one 7(12):e52799

Sequences

>TTHERM_01285910(coding)
ATGTTAGAAATTATTAAAGAAATTTAAAGATATTGTTTAAAAATTAGTTTATTAGCTAGC
TAAGATATTTTCAGGTCAAAATACAATTAATTAATTAGCAAAGATAATTTAAGAATATAA
TACAATTATTAATTTATAATAATTTGTTATAAAAAATTTAAAAAGCTAAAAAAATTTGTA
AATAATCTGAAAAATAAAATGAGTTAAATCTGTAGTATTCATTAATCTGAATTTATCAGC
CTTTGTGTTGATAAGAGTTGCAGCAATAGAAGCCTCATCTGCTAAGTGTGTGCTAGAGAG
AGTCATATGACCCATGTAATAATCCCTTTTTAGGAGTTTTGTGACTTTCTATACAACGAT
ATAAAGGCTAGTTAAACCTAAAGCGAGTTTGGTAGAGACATCAAAAATTAAGAATAAGAA
ATAGCCTATTTATTAACTTAACTTGAGAAGATAATTAAATCTATGTAAACGCTCAAATCT
AGCTTATAAATAACACTCTTGGAATAAAATGACTTACAAAAGAGGTTTTTAGAAAGAAAA
TTAGAATAATTTTAACATCAGATTAAAATTGTGCTAACCAAATAAGAAGGATACCAGGAA
ATCATCCGAAATATTATTTCTGAGCCAGATAGCTATACATTAAATGACAACAATTATCTC
ATGCAAATCTAATTTACAGAAATCGAAGGTCTGAAAGAAAAGTTTAATGATTTTTCTGAG
CAGTTCAAGAAATATCGCTCTAATGTATGTGAATATTTTTAACAAATTGAAGATGCTTTG
AATAAAGTATCAGCTTTTAAAGGCCCATAAATTGAAGAGTTAGACGAGAGCTTTTTAAAT
TATCAAAGCCATATTTCTCAGCAAAAAAGTTTATATTAAAATAAAAGAATTTATGAGCAA
GCAAATGTTTTAGAAACAGACAGAATCAATTGGAAAAATCGCTCTGTGATATCAGCAAGT
AATACCAATAATCCTCCAAGAGATGATTTCTAAAGTTCAGGCCTTAATCTTCGAAATTCA
TCTCAAAAGTTGACTAGAGAAGAATATTAAAATTAGATGCTATCGCCTTAGTAGAATGTT
TGTAAATTTAGATTCTAGCCTAATAACAAGAAAGAATTTCAAAGTGCTATGTAAGAAATT
ATTGGCAATTAGGGAATAAAGAGTCTATGGATTGATTTCCCTATTGACTCAGGAATCAAC
GAGATAAGATACTTGATCTAGGTCCTGAAATTGAAGCAAAACATCAAAAAGATCTTTTTA
AATTTTCCTAAGAGCATCACAATAAATAGCTTGGCATTTTAAGGATTGTTTGATTGTCTT
AAGAATTTAAGCAGTGTTGAAATATTATCATTAAAAATGAAAAAATGCTAAATAGAAGCC
TAATTCTCTTGGGATACTCTTTTAGATTCAATCTACTATCTTTCAAAGAAAAATTTACAA
AGGGTTTTACTTTTAGTCAGTGATTAAACAGGTAAAGAGATTAAGCAAAGAATATCCTAT
AGACCTCATTCGAATATTTTATATGAATTGATTGACTTTAATTGA


>TTHERM_01285910(protein)
MLEIIKEIQRYCLKISLLASQDIFRSKYNQLISKDNLRIQYNYQFIIICYKKFKKLKKFV
NNLKNKMSQICSIHQSEFISLCVDKSCSNRSLICQVCARESHMTHVIIPFQEFCDFLYND
IKASQTQSEFGRDIKNQEQEIAYLLTQLEKIIKSMQTLKSSLQITLLEQNDLQKRFLERK
LEQFQHQIKIVLTKQEGYQEIIRNIISEPDSYTLNDNNYLMQIQFTEIEGLKEKFNDFSE
QFKKYRSNVCEYFQQIEDALNKVSAFKGPQIEELDESFLNYQSHISQQKSLYQNKRIYEQ
ANVLETDRINWKNRSVISASNTNNPPRDDFQSSGLNLRNSSQKLTREEYQNQMLSPQQNV
CKFRFQPNNKKEFQSAMQEIIGNQGIKSLWIDFPIDSGINEIRYLIQVLKLKQNIKKIFL
NFPKSITINSLAFQGLFDCLKNLSSVEILSLKMKKCQIEAQFSWDTLLDSIYYLSKKNLQ
RVLLLVSDQTGKEIKQRISYRPHSNILYELIDFN


>TTHERM_01285910(gene)
CAAATAACTAACTATTGAATTCTAATTTATAATCAATAAATCACAAAAATATTTTATTTA
TGTTAGAAATTATTAAAGAAATTTAAAGATATTGTTTAAAAATTAGTTTATTAGCTAGCT
AAGATATTTTCAGGTCAAAATACAATTAATTAATTAGCAAAGATAATTTAAGAATATAAT
ACAATTATTAATTTATAATAATTTGTTATAAAAAATTTAAAAAGCTAAAAAAATTTGTAA
ATAATCTGAAAAATAAAATGAGTTAAATCTGTAGTATTCATTAATCTGAATTTATCAGCC
TTTGTGTTGATAAGAGTTGCAGCAATAGAAGCCTCATCTGCTAAGTGTGTGCTAGAGAGA
GTCATATGACCCATGTAATAATCCCTTTTTAGGAGTTTTGTGACTTTCTATACAACGATA
TAAAGGCTAGTTAAACCTAAAGCGAGTTTGGTAGAGACATCAAAAATTAAGAAGTAAAAT
ATATTTATTTATTTATTTAAAATAATTTTTTAAATTACTTTTATATATACAATAGTAAGA
AATAGCCTATTTATTAACTTAACTTGAGAAGATAATTAAATCTATGTAAACGCTCAAATC
TAGCTTATAAATAACACTCTTGGAATAAAATGACTTACAAAAGAGGTTTTTAGAAAGAAA
ATTAGAATAATTTTAACATCAGATTAAAATTGTGCTAACCAAATAAGAAGGATACCAGGA
AATCATCCGAAATATTATTTCTGAGCCAGATAGCTATACATTAAATGACAACAATTATCT
CATGCAAATCTAATTTACAGAAATCGAAGGTCTGAAAGAAAAGTTTAATGATTTTTCTGA
GCAGTTCAAGAAATATCGCTCTAATGTATGTGAATATTTTTAACAAATTGAAGATGCTTT
GAATAAAGTATCAGCTTTTAAAGGCCCATAAATTGAAGAGTTAGACGAGAGCTTTTTAAA
TTATCAAAGCCATATTTCTCAGCAAAAAAGTTTATATTAAAATAAAAGAATTTATGAGCA
AGCAAATGTTTTAGAAACAGACAGAATCAATTGGAAAAATCGCTCTGTGATATCAGCAAG
TAATACCAATAATCCTCCAAGAGATGATTTCTAAAGTTCAGGCCTTAATCTTCGAAATTC
ATCTCAAAAGTTGACTAGAGAAGAATATTAAAATTAGATGCTATCGCCTTAGTAGAATGT
TTGTAAATTTAGATTCTAGCCTAATAACAAGAAAGAATTTCAAAGTGCTATGTAAGAAAT
TATTGGCAATTAGGGAATAAAGAGTCTATGGATTGATTTCCCTATTGACTCAGGAATCAA
CGAGATAAGATACTTGATCTAGGTCCTGAAATTGAAGCAAAACATCAAAAAGATCTTTTT
AAATTTTCCTAAGTAAATTTAATTTAACACAATTGCTAGAATATTTTTTAGATAATAACT
TCTACTTTTATTTAATAAAGGAGCATCACAATAAATAGCTTGGCATTTTAAGGATTGTTT
GATTGTCTTAAGAATTTAAGCAGTGTTGAAATATTATCATTAAAAATGAAAAAGTAAAAT
AAAGAGATAAAATATTTGTTTTTTTTGATGATAATTTTTTTATAAATAAAATAGATGCTA
AATAGAAGCCTAATTCTCTTGGGATACTCTTTTAGATTCAATCTACTATCTTTCAAAGAA
AAATTTACAAAGGGTTTTACTTTTAGTCAGTGATTAAACAGGTAAAGAGATTAAGCAAAG
AATATCCTATAGACCTCATTCGAATATTTTATATGAATTGATTGACTTTAATTGAAGATA
AAATTAAGTTCTATCTATGTTCATGAACAATTTAAAATAAATTTATTAGTTATAATCAAT
ATTTTTTTATTTTTTGTGATTAAACATTTTCGTGAATTTATTCAATGATAATATTCAATG
TAATATTTTAGTTCGCTAATGTTTAAAATTGTTTTATTTGAC