Identifiers and Description

Gene Model Identifier

TTHERM_00317400

Standard Name

ZEF1 (Zinc finger/nuclear Export Factor fusion )

Aliases

PreTt21040 | 31.m00342 | 3687.m00144

Description

Fusion of two proteins involved in mRNA export, NF-X1 and GANP; SAC3/GANP family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00628 ) PHD-finger
  • ( PF03107 ) DC1 domain
  • ( PF07649 ) C1-like domain
  • ( PF00131 ) Metallothionein
  • ( PF03399 ) SAC3/GANP family
  • ( PF07945 ) Janus-atracotoxin
  • ( PF08067 ) ROKNT (NUC014) domain
  • ( PF01422 ) NF-X1 type zinc finger
  • ( PF03860 ) Domain of Unknown Function (DUF326)
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF00095 ) WAP-type (Whey Acidic Protein) 'four-disulfide
  • ( PF00130 ) Phorbol esters/diacylglycerol binding domain (C1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00317400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08355.19.997093137033517e-262GANP family protein (1113 aa)
OxytrichaContig16975.0.1.g311.0001999920370885e-161NF-X1 type zinc finger
WormBaseWBGene000070483.998986577109865e-118locus:nfx-1 Transcriptional
repressor NF-X1 homolog stat
us:Partially_confirmed UniPr
ot:Q18034 protein_id:CCD6322
7.1
DictyBaseDDB_G02935905.0000898401533074e-117DDB_G0293590 on chromosome: 6
position 3095576 to 3100096
SGDYNL023C4.001371804839974e-78FAP1 Protein that binds to Fpr
1p, conferring rapamycin resis
tance by competing with rapamy
cin for Fpr1p binding; accumul
ates in the nucleus upon treat
ment of cells with rapamycin;
has similarity to D. melanogas
ter shuttle craft and human NF
X1
Stentor CoeruleusSteCoe_293314.2960271311739114e-61

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00317400(coding)
ATGGATACAAAGGATAACTCTGAGTAGGCACAGTAATCTTCTTAGTCTACAAATGGTAAG
AAGATCTACAAAGACTCAGAATAGTAGCAAGGTTAAAAACCTAATTTTAATTCCAACTTC
CGTAATAATAACAACGGATAGTAAAATAATTTAGAATCCTCTGATATCGGAGTTGATAAA
AAATAAAAGAAACCCTTGAAATTAACTTCAAGTAATTTCAATGAAGTTAATAATAACAAC
AACAACAACAATAAAAATAAGGGTTAGGTAGTTTATGTTAGAGCTAATAATAATGCTCAA
CAAGAAGGCTAAAATGCTGAAGAACAAAAAAACAATTAACAAAGAAATTTAGAAAATCCT
AAAAAGGAATATGGATAGAATGTAAATAATAATAATAGCAATGGTAAAAGAAACTTTGAT
AGACCAAGAAAAGACAACTAATAAAATTAGGGTGAATAATAGTAAGGAAATAACAGAAGA
TAAGGTAACAGAAATAATGGATAAAGACAAGGAGATTAGGAAAAGTAGGTTAAATAATAA
GGAAATCCAAATCAATAAAAAAATGAATTTAATAGAGGCTAAGAATATTAAAATGAAATT
AAAAGTGAAAGATAGAATATAAAGGAAGGTTAAAGCAGTGATCCTGACTAAAACGAGTAA
AATCATGAAAAAAATGTTAATAGATTTAAGAAGCCAAACCAAAGAGGTGAAAATTTTGGC
TAAAATCAAAATAATAGAGAATAAGGTTTAGATTCATAGCAATCATAAAATAGAGGATAG
AATAAGCCTTAAAGCAGATAAGGAGGATACAATCAATAATAATAAAATAGAACTTATGAG
AGGAAAGAAAAAAAACCTTTTAATAAAAAGGAAAATGCCGATGCTGATAAATAAAGCTAA
CTATAAAATAGAAAGATTAGAGAAGAAGAAAAATTGAGAAGAGAAGAATAAGAAGGAATT
GATCCTGATGAGTAAGATATTATAGATGATGGCGGTGCTGCAGATGAAGGGGAAGATTAA
GTTTTTGATATTTTAAAAGAAAACAAAAATACATTAAGAGATACATTGATAAAAAGATTA
AAGAGAAAGAAAATTGATTGTCCTATATGCTATGAAAAAATAGGACTTCGCTCATCTATG
TGGTCTTGTGTATAATGCTATCACCCTTTCCATTTAGAGTGCTTGAAAAAGTGGATTTAT
AATTCAAATAAAGACAGAAAGAATTTCACACTATATAATTGGAGCTGTCCCAATTGCCAA
TACATTTACAGCGACAAGATGCCAACTTATGCTTGCTTCTGTGGAAAATATAAAAACCCT
GAATTTGATCCTTATATTAATCCTCATAGTTGTGGAGATACATGTGGAAAAAAAAGAGGA
AACAATTGCACTCATCCTTGTGATGTTCCATGCCACCCAGGACCTTGTCCTCCTTGTACT
TTAAAGGGAGAACCTATTAGATGCTACTGCAAGAAGTAAAAGAAAGATGTTTTTTGTTCA
GACAATCAAACTTCTTACGAATGTGGCCAATAATGTTAAAAAGTTCTTAACTGTGGAAAG
CATTTTTGTGAAAAAAATTGTCATGCTGGAGAATGCAACAAATGTACTTAATAAGTAGAA
GCTGTTTGTTTTTGTGGTGAAGAGAAAAAAAGTGCTATCTGTGGTTAAAATTTGTTTGCT
TGTAATAGAAAATGCAACAAAACATTAGATTGTGGAAATCATAAATGCTAATAATAATGT
CATCCAGGACCTTGTGCTAAATGTGAATTGAACCCCGAAGATGTCGATACTTGTCCTTGC
GGAAAAAACACTCTGCTTACATTGGCAGGTGGTAATTTCAGAGAGGAATGCACAGACCCT
ATTCCTGTATGTGGAAATCCATGCAAAAAAGTATTATCTTGTGGAGTACATTTTTGTAAG
AAGTCTTGTCATGAAGGCTCTTGTCCACCATGTAAGGAATCTGTAGAGGAACTTTGCAGA
TGTAAATTTAATAGCAGAATTGTTTAATGCTATGAATTAAGAGAAGCTGATCACTAGTAA
TTTATTTGTGATAGAGTTTGCAAAAAGCTCAAATCATGCAATGTCCATCCATGTAACACA
CCATGCTGCCCTGCAAGAAAAGGATAAGATGTAGATGGAGTTCATCTTTGCTTGAAGGTA
TGTGAAAAGCCATTAAATTGTGGAAAACATAATTGTGAACTCTTTTGTCACTTAGGTATT
TGTCCAAAATGCCCAATAAAAATAAATGAGCCTATAACCTGTGTTTGTGGAAAAACTTCC
CTAGCTCCTCCTTAACCATGTGGAACAAAACCTCCTGAGTGTCACGAGCCTTGCTCCAGA
CAAAAGCCCTGCGGACATCCTTGCCACTTAGATTGTCATCAAGACGAATGTCCTCCTTGT
GAGTACAAAGTCGATAAAGTCTGTCACTGTGGTAGATAAGTTGTGAAGGATGTCAGTTGC
TCTAAAGATGCCCTATGCACAGTCGCTTGCAATAAAATAATGTCTTGTGGCCATAAATGT
GAAACTGTATGCCATGTTGGAGAATGTCCAAAAGACAATCCTTAGTAAGGTTGTGGAAGA
AAATGTGGTAGAAAGAGAAAATTCTGCGAGCATATCTGTGTCTCTATTTGCCATGGAATG
TCTGAGTGTCCATAGGATCCTTGTAAAGTCGAAATAGTAATTAAATGTAAGTGTGGAGAA
AGAGAAGCTTTTGTTGAATGTGGATCATCAGACAGTGCTTTAGATAGAACTCTTGCTTGC
AACGAACTATGCAAAAATATTAAAAGATTTGCCTTCTTCCATGATAAAAACAAAATTTAT
TATCCTGCACTTCTCATTCGTTTTGCTAAGTTCTATATGGTTTACCTTCTTAAGATAGAA
AAGAAGATTGAAACATTTATCAAATCAAATGATAAAGAGCTCACCATTCCTTTCTAGAAT
GATGATTATTCTAAGAAATTCGGTCTCTAATCCTTGCTTGGTAAGCATTACCACTTGAAT
GTTTAATACTACAATCATTTCAAGTAGCCCTACTTTGTGATAGAAAAGAGTTCAGATATG
GTTATTCCAAAAATGACTCTTTCAGAATACTACAGAAAGGTTGAAAAGGGTGAAATAAAA
CCAGAAGTTCTTCCTTTTGAGGCATCCATTAAATTTATCAATAGCATAAGAGATGACCCT
AATCATTAAGTACTTGAAAATATCCTTAGAGACTTCGCAAAAGAGTACTATGTTGAAAAA
GAAGACCGTTAATTGGTTATCCATTTCTGGGAAAAGAGTAAGGCTGAAATGGCTTCTAAA
AAATTGAAGAAGAGTACAACCGGTTACAGTAACTTTACTTTAGAAATTAATGAAAGACTT
GTCAAAGAAGAAGAGAGCTAAATGACAGCACCTAACGAAGTTACTAGAGTCAAAAAACGT
ATCATAACAAAGACTGAATAAGAGGCTCCCTAGCACAGTGACGATGAAGAAGAAAAGCAA
CTTAAATTAAATAAAGAATAGTCATAAATAATTTAATAAAGGGAGTACTTTAAAGACAAA
GCTTGTCTTTATGAAATGTGCTCTCAAACTGAAATCGATGAAAGAACTTCACGTATGCTA
ATAGATATTTTTGAATAGGATCCTAGAACTGGATAAATGTCACCATATAATAAGTGGATG
GTTAAAGCATATCTTAGAACCAGCTAAACTAATACTCAGCCTGAGAATATCCGTCCTCCT
GATGTCCTTCTCCTGACAACAAAATACTTAGTGAATAAAATTCTAGATGCTAATTTCTAT
GTAAATGTACCTTTCAAGTACCCCAGAGACAAGCAAGGCAAGAGACGCAGCCATACATTC
GATGATATATATAATTTTGTTAGTGATAGATTCAAAGCAATCAGATAAGACATCACCATA
TTAAATTACACAACTGAAGAGACTATTTATGTTATGGAAATCATTTGTAGATTCTATGCT
ATCTGCTTGTATGAATGCCAAAATATCGAATAAGGATATGACAGGAAAATTTTAATTGAC
GATCTTTAAACATCTTTATCTCAACTATTGAATATGTATCAAGATATTAATGATTATGCT
TATGTTGATAACAAATATGAAATGTACTTCTACACTCTTATTCTCAACGCTAGAGACGAC
ATATTTATAAATAAATTCTTAGCTACTATTCCTGACCCAGACCACTAAAAAGTAAAAACT
GCTTTATAGATTATTGACTGTGTTAAGAATTTAGATTACTTCAACTTCTTTTAGATTGTG
AAATAACTTGACTATATTGAAACCTGTGTTGTCTTCAATCTTTTCCCTTACATAAGAAAC
CAAGCAGTTAGTATTATGAGAAAATCAAAATTAGCTAAGACTGTTGCAGAAATTTAAGAG
TTATTCTTCTTTGATTCTTCAGAATAAACAGTAGAATTTTTGAAAACAATTGGATTAGAT
ACTTCCAAATTGAGTCTTCCTCCTCAATATGAGACAGGTAATGAAGATGAACTTAAGCAA
GCCAAAAAGGAAAATGAATAAGTAAAGAGTGAGGGTAATGATGATACTAAAACCTCAGAT
TAATAACAAGGCCAAGACTAAGATAATTTAAATATAAATTCTAATACCGAAATATAAAAG
AATAAAAATCTCAACTTAGAAGAAAATGGTGAAAAATTAAATTAAACTGAAGCAGAAGAT
ATTAAAAACTCATCTAAACCTGATTAAAAAGAAGAAGAAGGAAAAGCAGAAGAAGAAGGA
GAATAAGAAGAAGAAGAAAAATAAATCGAAGAAGAAAAACCCAAAAAGTATAAGCTTAAA
AAAGTGTTTATTGATTGGAAAATAATATATGAAAATACTGAATACTCATTCAAAGAAATA
AACTTGAGAATTAGTGATAAAAAATCAATAGATTATTATCCTAATTATAAGTAAATAAAA
GCTACAAACAACGATAATATCGTTACAAGAGCTTTCTTAGTTATGGGATTTAAATCTAAA
ATCCAAAGTTAATCAGAAGAAGCAAGCGAATAAGATTAATAATAACAAGTTTAAGAACAA
GAAAAAAATGAATGA


>TTHERM_00317400(protein)
MDTKDNSEQAQQSSQSTNGKKIYKDSEQQQGQKPNFNSNFRNNNNGQQNNLESSDIGVDK
KQKKPLKLTSSNFNEVNNNNNNNNKNKGQVVYVRANNNAQQEGQNAEEQKNNQQRNLENP
KKEYGQNVNNNNSNGKRNFDRPRKDNQQNQGEQQQGNNRRQGNRNNGQRQGDQEKQVKQQ
GNPNQQKNEFNRGQEYQNEIKSERQNIKEGQSSDPDQNEQNHEKNVNRFKKPNQRGENFG
QNQNNREQGLDSQQSQNRGQNKPQSRQGGYNQQQQNRTYERKEKKPFNKKENADADKQSQ
LQNRKIREEEKLRREEQEGIDPDEQDIIDDGGAADEGEDQVFDILKENKNTLRDTLIKRL
KRKKIDCPICYEKIGLRSSMWSCVQCYHPFHLECLKKWIYNSNKDRKNFTLYNWSCPNCQ
YIYSDKMPTYACFCGKYKNPEFDPYINPHSCGDTCGKKRGNNCTHPCDVPCHPGPCPPCT
LKGEPIRCYCKKQKKDVFCSDNQTSYECGQQCQKVLNCGKHFCEKNCHAGECNKCTQQVE
AVCFCGEEKKSAICGQNLFACNRKCNKTLDCGNHKCQQQCHPGPCAKCELNPEDVDTCPC
GKNTLLTLAGGNFREECTDPIPVCGNPCKKVLSCGVHFCKKSCHEGSCPPCKESVEELCR
CKFNSRIVQCYELREADHQQFICDRVCKKLKSCNVHPCNTPCCPARKGQDVDGVHLCLKV
CEKPLNCGKHNCELFCHLGICPKCPIKINEPITCVCGKTSLAPPQPCGTKPPECHEPCSR
QKPCGHPCHLDCHQDECPPCEYKVDKVCHCGRQVVKDVSCSKDALCTVACNKIMSCGHKC
ETVCHVGECPKDNPQQGCGRKCGRKRKFCEHICVSICHGMSECPQDPCKVEIVIKCKCGE
REAFVECGSSDSALDRTLACNELCKNIKRFAFFHDKNKIYYPALLIRFAKFYMVYLLKIE
KKIETFIKSNDKELTIPFQNDDYSKKFGLQSLLGKHYHLNVQYYNHFKQPYFVIEKSSDM
VIPKMTLSEYYRKVEKGEIKPEVLPFEASIKFINSIRDDPNHQVLENILRDFAKEYYVEK
EDRQLVIHFWEKSKAEMASKKLKKSTTGYSNFTLEINERLVKEEESQMTAPNEVTRVKKR
IITKTEQEAPQHSDDEEEKQLKLNKEQSQIIQQREYFKDKACLYEMCSQTEIDERTSRML
IDIFEQDPRTGQMSPYNKWMVKAYLRTSQTNTQPENIRPPDVLLLTTKYLVNKILDANFY
VNVPFKYPRDKQGKRRSHTFDDIYNFVSDRFKAIRQDITILNYTTEETIYVMEIICRFYA
ICLYECQNIEQGYDRKILIDDLQTSLSQLLNMYQDINDYAYVDNKYEMYFYTLILNARDD
IFINKFLATIPDPDHQKVKTALQIIDCVKNLDYFNFFQIVKQLDYIETCVVFNLFPYIRN
QAVSIMRKSKLAKTVAEIQELFFFDSSEQTVEFLKTIGLDTSKLSLPPQYETGNEDELKQ
AKKENEQVKSEGNDDTKTSDQQQGQDQDNLNINSNTEIQKNKNLNLEENGEKLNQTEAED
IKNSSKPDQKEEEGKAEEEGEQEEEEKQIEEEKPKKYKLKKVFIDWKIIYENTEYSFKEI
NLRISDKKSIDYYPNYKQIKATNNDNIVTRAFLVMGFKSKIQSQSEEASEQDQQQQVQEQ
EKNE


>TTHERM_00317400(gene)
ATGGATACAAAGGATAACTCTGAGTAGGCACAGTAATCTTCTTAGTCTACAAATGGTAAG
AAGATCTACAAAGACTCAGAATAGTAGCAAGGTTAAAAACCTAATTTTAATTCCAACTTC
CGTAATAATAACAACGGATAGTAAAATAATTTAGAATCCTCTGATATCGGAGTTGATAAA
AAATAAAAGAAACCCTTGAAATTAACTTCAAGTAATTTCAATGAAGTTAATAATAACAAC
AACAACAACAATAAAAATAAGGGTTAGGTAGTTTATGTTAGAGCTAATAATAATGCTCAA
CAAGAAGGCTAAAATGCTGAAGAACAAAAAAACAATTAACAAAGAAATTTAGAAAATCCT
AAAAAGGAATATGGATAGAATGTAAATAATAATAATAGCAATGGTAAAAGAAACTTTGAT
AGACCAAGAAAAGACAACTAATAAAATTAGGGTGAATAATAGTAAGGAAATAACAGAAGA
TAAGGTAACAGAAATAATGGATAAAGACAAGGAGATTAGGAAAAGTAGGTTAAATAATAA
GGAAATCCAAATCAATAAAAAAATGAATTTAATAGAGGCTAAGAATATTAAAATGAAATT
AAAAGTGAAAGATAGAATATAAAGGAAGGTTAAAGCAGTGATCCTGACTAAAACGAGTAA
AATCATGAAAAAAATGTTAATAGATTTAAGAAGCCAAACCAAAGAGGTGAAAATTTTGGC
TAAAATCAAAATAATAGAGAATAAGGTTTAGATTCATAGCAATCATAAAATAGAGGATAG
AATAAGCCTTAAAGCAGATAAGGAGGATACAATCAATAATAATAAAATAGAACTTATGAG
AGGAAAGAAAAAAAACCTTTTAATAAAAAGGAAAATGCCGATGCTGATAAATAAAGCTAA
CTATAAAATAGAAAGATTAGAGAAGAAGAAAAATTGAGAAGAGAAGAATAAGAAGGAATT
GATCCTGATGAGTAAGATATTATAGATGATGGCGGTGCTGCAGATGAAGGGGAAGATTAA
GTTTTTGATATTTTAAAAGAAAACAAAAATACATTAAGAGATACATTGATAAAAAGATTA
AAGAGAAAGAAAATTGATTGTCCTATATGCTATGAAAAAATAGGACTTCGCTCATCTATG
TGGTCTTGTGTATAATGCTATCACCCTTTCCATTTAGAGTGCTTGAAAAAGTGGATTTAT
AATTCAAATAAAGACAGAAAGAATTTCACACTATATAATTGGAGCTGTCCCAATTGCCAA
TACATTTACAGCGACAAGATGCCAACTTATGCTTGCTTCTGTGGAAAATATAAAAACCCT
GAATTTGATCCTTATATTGTAAGCAGCAATTTATTCATAATAATAATAATAATATAAATC
ATTTATTTATTTAAAAATTTAGAATCCTCATAGTTGTGGAGATACATGTGGAAAAAAAAG
AGGAAACAATTGCACTCATCCTTGTGATGTTCCATGCCACCCAGGACCTTGTCCTCCTTG
TACTTTAAAGGGAGAACCTATTAGATGCTACTGCAAGAAGTAAAAGAAAGATGTTTTTTG
TTCAGACAATCAAACTTCTTACGAATGTGGCCAATAATGTTAAAAAGTTCTTAACTGTGG
AAAGCATTTTTGTGAAAAAAATTGTGTAAATAAAATAAATTTTTAAAATAAAATAAATAA
ATTTTTCATTTTATTCTAATTATATTTTTACATAAAAAGCATGCTGGAGAATGCAACAAA
TGTACTTAATAAGTAGAAGCTGTTTGTTTTTGTGGTGAAGAGAAAAAAAGTGCTATCTGT
GGTTAAAATTTGTTTGCTTGTAATAGAAAATGCAACAAAACATTAGATTGTGGAAATCAT
AAATGCTAATAATAATGTCATCCAGGGTATTGTTTATTTGTGTTAATTTAATATTTTTAA
ATGTTTAATTATTATACAAAGACCTTGTGCTAAATGTGAATTGAACCCCGAAGATGTCGA
TACTTGTCCTTGCGGAAAAAACACTCTGCTTACATTGGCAGGTGGTAATTTCAGAGAGGA
ATGCACAGACCCTATTCCTGTATGTGGAAATCCATGCAAAAAAGTATTATCTTGTGGAGT
ACATTTTTGTAAGAAGTCTTGTCATGAAGTAAGCAATTATTTAATATGAGTTTCAAATTT
AATCAAATTTTTTTTATTTTGAAGGGCTCTTGTCCACCATGTAAGGAATCTGTAGAGGAA
CTTTGCAGATGTAAATTTAATAGCAGAATTGTTTAATGCTATGAATTAAGAGAAGCTGAT
CACTAGTAATTTATTTGTGATAGAGTTTGCAAAAAGCTCAAATCATGCAATGTCCATCCA
TGTAACACACCATGCTGCCCTGCAAGAAAAGGATAAGATGTAGATGGAGTTCATCTTTGC
TTGAAGGTATGTGAAAAGCCATTAAATTGTGGAAAACATAATTGTGAACTCTTTTGTCAC
TTAGGTATTTGTCCAAAATGCCCAATAAAAATAAATGAGCCTATAACCTGTGTTTGTGGA
AAAACTTCCCTAGCTCCTCCTTAACCATGTGGAACAAAACCTCCTGAGTGTCACGAGCCT
TGCTCCAGACAAAAGCCCTGCGGACATCCTTGCCACTTAGATTGTCATCAAGACGAATGT
CCTCCTTGTGAGTACAAAGTCGATAAAGTCTGTCACTGTGGTAGATAAGTTGTGAAGGAT
GTCAGTTGCTCTAAAGATGCCCTATGCACAGTCGCTTGCAATAAAGTAAATTAAAATCTT
TTGGAAATTTTAATGTTAATATTTTTAAATATTTATTAAGATAATGTCTTGTGGCCATAA
ATGTGAAACTGTATGCCATGTTGGAGAATGTCCAAAAGACAATCCTTAGTAAGGTTGTGG
AAGAAAATGTGGTAGAAAGAGAAAATTCTGCGAGCATATCTGTGTCTCTATTTGCCATGG
AAGTAAACAAAAATATTTTTAAAATTATAATTAATTAATCATAAATATTTAAATGATAAA
GTGTCTGAGTGTCCATAGGATCCTTGTAAAGTCGAAATAGTAATTAAATGTAAGTGTGGA
GAAAGAGAAGCTTTTGTTGAATGTGGATCATCAGACAGTGCTTTAGATAGAACTCTTGCT
TGCAACGAACTATGCAAAAATATTAAAAGATTTGCCTTCTTCCATGATAAAAACAAAATT
TATTATCCTGCACTTCTCATTCGTTTTGCTAAGTTCTATATGGTTTACCTTCTTAAGATA
GAAAAGAAGATTGAAACATTTATCAAATCAAATGATAAAGAGCTCACCATTCCTTTCTAG
AATGATGATTATTCTAAGAAATTCGGTCTCTAATCCTTGCTTGGTAAGCATTACCACTTG
AATGTTTAATACTACAATCATTTCAAGTAGCCCTACTTTGTGATAGAAAAGAGTTCAGAT
ATGGTTATTCCAAAAATGACTCTTTCAGAATACTACAGAAAGGTTGAAAAGGGTGAAATA
AAACCAGAAGTTCTTCCTTTTGAGGCATCCATTAAATTTATCAATAGCATAAGAGATGAC
CCTAATCATTAAGTACTTGAAAATATCCTTAGAGACTTCGCAAAAGAGTACTATGTTGAA
AAAGAAGACCGTTAATTGGTTATCCATTTCTGGGAAAAGGTAATTAATATTAAAATTTAT
TATTTTTAGAAAATGAAACTCATATTATTTGAATGAATATTAGAGTAAGGCTGAAATGGC
TTCTAAAAAATTGAAGAAGAGTACAACCGGTTACAGTAACTTTACTTTAGAAATTAATGA
AAGACTTGTCAAAGAAGAAGAGAGCTAAATGACAGCACCTAACGAAGTTACTAGAGTCAA
AAAACGTATCATAACAAAGACTGAATAAGAGGCTCCCTAGCACAGTGACGATGAAGAAGA
AAAGCAACTTAAATTAAATAAAGAATAGTCATAAATAATTTAATAAAGGGAGTACTTTAA
AGACAAAGCTTGTCTTTATGAAATGTGCTCTCAAACTGAAATCGATGAAAGAACTTCACG
TATGCTAATAGATATTTTTGAATAGGATCCTAGAACTGGATAAATGTCACCATATAATAA
GTGGATGGTTAAAGCATATCTTAGAACCAGCTAAACTAATACTCAGCCTGAGAATATCCG
TCCTCCTGATGTCCTTCTCCTGACAACAAAATACTTAGTGAATAAAATTCTAGATGCTAA
TTTCTATGTAAATGTACCTTTCAAGTACCCCAGAGACAAGCAAGGCAAGAGACGCAGCCA
TACATTCGATGATATATATAATTTTGTTAGTGATAGATTCAAAGCAATCAGATAAGACAT
CACCATATTAAATTACACAACTGAAGAGACTATTTATGTTATGGAAATCATTTGTAGATT
CTATGCTATCTGCTTGTATGAATGCCAAAATATCGAATAAGGATATGACAGGAAAATTTT
AATTGACGATCTTTAAACATCTTTATCTCAACTATTGAATATGTATCAAGATATTAATGA
TTATGCTTATGTTGATAACAAATATGAAATGTACTTCTACACTCTTATTCTCAACGCTAG
AGACGACATATTTATAAATAAATTCTTAGCTACTATTCCTGACCCAGACCACTAAAAAGT
AATCATTTATTTTATATTTTAATCGAATATATTCTCATTTTTTTTAATTTTAATTAAAGG
TAAAAACTGCTTTATAGATTATTGACTGTGTTAAGAATTTAGATTACTTCAACTTCTTTT
AGATTGTGAAATAACTTGACTATATTGAAACCTGTGTTGTCTTCAATCTTTTCCCTTACA
TAAGAAACCAAGCAGTTAGTATTATGAGAAAATCAAAATTAGCTAAGACTGTTGCAGAAA
TTTAAGAGTTATTCTTCTTTGATTCTTCAGAATAAACAGTAGAATTTTTGAAAACAATTG
GATTAGATACTTCCAAATTGAGTCTTCCTCCTCAATATGAGACAGGTAATGAAGATGAAC
TTAAGCAAGCCAAAAAGGAAAATGAATAAGTAAAGAGTGAGGGTAATGATGATACTAAAA
CCTCAGATTAATAACAAGGCCAAGACTAAGATAATTTAAATATAAATTCTAATACCGAAA
TATAAAAGAATAAAAATCTCAACTTAGAAGAAAATGGTGAAAAATTAAATTAAACTGAAG
CAGAAGATATTAAAAACTCATCTAAACCTGATTAAAAAGAAGAAGAAGGAAAAGCAGAAG
AAGAAGGAGAATAAGAAGAAGAAGAAAAATAAATCGAAGAAGAAAAACCCAAAAAGTATA
AGCTTAAAAAAGTGTTTATTGATTGGAAAATAATATATGAAAATACTGAATACTCATTCA
AAGAAATAAACTTGAGAATTAGTGATAAAAAATCAATAGATTATTATCCTAATTATAAGT
AAATAAAAGCTACAAACAACGATAATATCGTTACAAGAGCTTTCTTAGTTATGGGATTTA
AATCTAAAATCCAAAGTTAATCAGAAGAAGCAAGCGAATAAGATTAATAATAACAAGTTT
AAGAACAAGAAAAAAATGAATGA