Identifiers and Description

Gene Model Identifier

TTHERM_00300470

Standard Name

YRS3 (tyrosyl-tRNA synthetase)

Aliases

PreTt19342 | 28.m00301 | 3691.m00119

Description

tyrosyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00300470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07680.19.997093137033517e-262tyrosyl-tRNA synthetase (1149
aa)
OxytrichaContig22340.0.g912.000724368835138e-100tRNA synthetases class I (W an
d Y)
DictyBaseDDB_G02797158.001734810345018e-90mtyrS on chromosome: 3 positio
n 2475392 to 2476840
SGDYPL097W3.000074895537278e-78MSY1 Mitochondrial tyrosyl-tRN
A synthetase
WormBaseWBGene000069681.9997255150861791e-53locus:yars-1 status:Confirme
d UniProt:H2KZL6 protein_i
d:CCD68724.1
Stentor CoeruleusSteCoe_117521.3336148155022614e-34

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00300470(coding)
ATGTAAAGGATACTTTAAAACAATTTATAGAAGCAATCTAGATTTTTATTTTAAAACAAA
GTAGCTTTTTATTTTTCAAGCAACTAACTCCACTCTAAAGTTGGTCCTGCTAAAGAATTA
TAAAATAGAGAGCTTTTATTTTAGTGTACAAATGATATTCTTACAAAGGATACTTTCTAC
TAACATTTAATCTAACAATATAATGCATAAGGTGATAAATAAGTAAATAATTAAAAATAA
TTCAGCGCATATGCAGGATTTGATCCAACTGCTGATTCCCTCCACATGGGAAATTTGATT
TCTATTCTTACAATGATCCGCCTTAGTTTATTAGGAATAAAGCCAATTCTTCTTGTAGGA
GGAGCAACTGGTTTAATTGGAGATCCTTCTGGAAAAACATAAGAGAGAAATATGCTTACA
AAAGAAGAAGTTTTAAGTAATGTATAGGGCATAGAAAATACCTTAAGAAAATGCACTAGC
AACATATACAGTTTTCTTGAAAAAAATAAACAAAAATTAGAAATAGATTATATCCCTGCA
AAAGAAGACTTATAGATAATAAATAACTACGATTTCTATAAAGATATGAACATACTTGAT
TTTATTAGAGATATTGGAAAGCACTTTAGAATGGGAAATCTTTTGAATAAGGAGACTATA
GCTAATAGACTTAACACTGAAGATGGACTTTCATACACAGAATTCACTTACACACTACTT
TAAGGCTACGACTTTGAAAAATTGTTTTTAGATAAGAACTGTATAATTTAAGTTGGTGGT
AGTGATTAGTGGGGTAATATAACTAGTGGAATCGAATTGATTAGAAGAAAGCATAGAGCT
GAAGTTTATGGTATTACTACAAATTTAGTTTTAACTGCTTAAGGAAAGAAGTTTGGAAAA
AGTGAAGGGAATGCTCTCTGGTTAGATCCTGCTAAAACTAAATCTTATGATATATTTTAA
TATTTGATAAATGTACCAGATTAGCTATCTATAAATTATTTGAAAATGTTTAGTTTCTTA
CCTTTACACTAAATAGAAGAGATTGAGAAAAAGCATATGGAAGATGCAGGAAAGAGATTA
GCCTAGAATACATTAGCAGAATAGATTATCGGAATGGTATAAGGAGATAGTTAATCAGCA
GAATAAGGGGCATAAACAACTGCTTAAAAATTTTTCACAACAGATTTTTCTAAATTTAAT
GAGAAATCTGAGTCAGAGATAATAGAATTCTTTAGCTCATTTAATGAAAAACATACTGTT
GAAAGAAAGGATCTTTAAAAATACAAAAATTATATTGATATGATAGGAGATTTAAAGCTT
TTAAAAAATAAAGCTGAAATTAAAAGAAATATTGAAAATGGAGGTGCTTATATTAATAAT
AAGAGAATAAGCTTAGTAGATTCTGATAACTTGCAAACCTTATTATCTGAAAATCTGCTT
GCTAACAGATTTTTAGTTGCTAGGTTTGGAAAGAAAAATTACTACTTAATTGAAGTAAAA
TGA


>TTHERM_00300470(protein)
MQRILQNNLQKQSRFLFQNKVAFYFSSNQLHSKVGPAKELQNRELLFQCTNDILTKDTFY
QHLIQQYNAQGDKQVNNQKQFSAYAGFDPTADSLHMGNLISILTMIRLSLLGIKPILLVG
GATGLIGDPSGKTQERNMLTKEEVLSNVQGIENTLRKCTSNIYSFLEKNKQKLEIDYIPA
KEDLQIINNYDFYKDMNILDFIRDIGKHFRMGNLLNKETIANRLNTEDGLSYTEFTYTLL
QGYDFEKLFLDKNCIIQVGGSDQWGNITSGIELIRRKHRAEVYGITTNLVLTAQGKKFGK
SEGNALWLDPAKTKSYDIFQYLINVPDQLSINYLKMFSFLPLHQIEEIEKKHMEDAGKRL
AQNTLAEQIIGMVQGDSQSAEQGAQTTAQKFFTTDFSKFNEKSESEIIEFFSSFNEKHTV
ERKDLQKYKNYIDMIGDLKLLKNKAEIKRNIENGGAYINNKRISLVDSDNLQTLLSENLL
ANRFLVARFGKKNYYLIEVK


>TTHERM_00300470(gene)
ATGTAAAGGATACTTTAAAACAATTTATAGAAGCAATCTAGATTTTTATTTTAAAACAAA
GTAGCTTTTTATTTTTCAAGCAACTAACTCCACTCTAAAGTTGGTCCTGCTAAAGAATTA
TAAAATAGAGAGCTTTTATTTTAGTGTACAAATGATATTCTTACAAAGGATACTTTCTAC
TAACATTTAATCTAACAATATAATGCATAAGGTGATAAATAAGTAAATAATTAAAAATAA
TTCAGCGCATATGCAGGATTTGATCCAACTGCTGATTCCCTCCACATGGGAAATTTGATT
TCTATTCTTACAATGATCCGCCTTAGTTTATTAGGAATAAAGCCAATTCTTCTTGTAGGA
GGAGCAACTGGTTTAATTGGAGATCCTTCTGGAAAAACATAAGAGAGAAATATGCTTACA
AAAGAAGAAGTTTTAAGTAATGTATAGGGCATAGAAAATACCTTAAGAAAATGCACTAGC
AACATATACAGTTTTCTTGAAAAAAATAAACAAAAATTAGAAATAGATTATATCCCTGCA
AAAGTAATTTGTTATTGAATCTTAATTTAAGAAATAGAAATTTTTGAAAGTTTAATGTCC
TCAAAAACTAAATTCAATAGATACTGATACAAACATAATAAGCAAAGTATTAATGTTTCT
TTTATTAATTTAAAAGGAAGACTTATAGATAATAAATAACTACGATTTCTATAAAGATAT
GAACATACTTGATTTTATTAGAGATATTGGTAAAATTAAATATTCTTAAAAATTATTATG
TTTATTTATTTGTTTGTTTGTTTAAACTTCTACTTACTATTTCTTAATTTTATTTTTTAA
ATTTTTTACCTATTTCTTTTATAGGAAAGCACTTTAGAATGGGAAATCTTTTGAATAAGG
AGACTATAGCTAATAGACTTAACACTGAAGATGGACTTTCATACACAGAATTCACTTACA
CACTACTTTAAGGCTACGACTTTGAAAAATTGTTTTTAGATAAGGTATTTATTAAATAAT
TATTGACCAATATAATTATTTTCAAAATAGTATTTTCATATCAATAAATGTTTAATTTAA
ATAGAACTGTATAATTTAAGTTGGTGGTAGTGATTAGTGGGGTAATATAACTAGTGGAAT
CGAATTGATTAGAAGAAAGCATAGAGCTGAAGTTTATGGTATTACTACAAATTTAGTTTT
AACTGCTTAAGGAAAGAAGTTTGGAAAAAGTGAAGGGAATGCTCTCTGGTTAGATCCTGC
TAAAACTAAATCTTATGATATATTTTAATATTTGATAAATGTACCAGATTAGCTATCTAT
AAATTATTTGAAAATGTTTAGTTTCTTACCTTTACACTAAATAGAAGAGGTATATTTTTT
ATTTTTTTTATCACTATTTAAATTTTGATTTTTATTAGATTGAGAAAAAGCATATGGAAG
ATGCAGGAAAGAGATTAGCCTAGAATACATTAGCAGAATAGATTATCGGAATGGTATAAG
GAGATAGTTAATCAGCAGAATAAGGGGCATAAACAACTGCTTAAAAATTTTTCACAACAG
ATTTTTCTAAATTTGTAAATAATTCATTTGAATCATGAATTTAAAAAATAAAACCAATAA
ACATAAAAGAGAATAAATTAAAAACTTTTTCTATTTGTATAAAAAGAATGAGAAATCTGA
GTCAGAGATAATAGAATTCTTTAGCTCATTTAATGAAAAACATACTGTTGAAAGAAAGGA
TCTTTAAAAATACAAAAATTATATTGATATGATAGGAGATTTAAAGCTTTTAAAAAATAA
AGCTGAAATTAAAAGAAATATTGAAAATGGAGGTGCTTATATTAATAATAAGAGAATAAG
CTTAGTAGATTCTGATAACTTGCAAACCTTATTATCTGAAAATCTGCTTGCTAACAGATT
TTTAGTTGCTAGGTTTGGAAAGAAAAATTACTACTTAATTGAAGTAAAATGA