Identifiers and Description

Gene Model Identifier

TTHERM_00149980

Standard Name

YRS2 (tyrosyl-tRNA synthetase 2)

Aliases

PreTt20758 | 12.m00432 | 3700.m00153

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_00149980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05061.19.997093137033517e-262hypothetical protein (435 aa)
OxytrichaContig1758.0.g1072.0009356157506544e-160tRNA synthetases class I (W an
d Y)
DictyBaseDDB_G02767215.998558726299043e-153tyrS on chromosome: 2 position
7137404 to 7138750
Stentor CoeruleusSteCoe_147971.462486227251231e-31
SGDYGR185C1.999981404597394e-31TYS1 Cytoplasmic tyrosyl-tRNA
synthetase, required for cytop
lasmic protein synthesis; inte
racts with positions 34 and 35
of the tRNATyr anticodon; mut
ations in human ortholog YARS
are associated with Charcot-Ma
rie-Tooth (CMT) neuropathies
WormBaseWBGene000136770.00000000009998509410508463status:Confirmed UniProt:G5E
D95 protein_id:CAD21668.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00149980(coding)
ATGGATACAAAAATCAACTACTTGACTGGTGGATTGCAATTTAAGCTTCATGACGATATC
GAAGAAGAAGTAGTTTAGCTTAAATAAAATCTTTAAAGAATGTATAAACCAATAGCACCC
TCCGTAGATTTAAATGCTGCTTTTGACCCTTAACCCAGCAAGTTATCTTTGAAACAAAGA
TTCTAACTCATTAAGAGTTTTGCTGAAGAAATAATTCAAGAAAATGAACTCGTAAAGTTA
TTATCTACAAAGCAATTCCCTATTTGCTATGATGGATTCGAACCATCAGGTAGAATGCAC
ATAGCATAAGGTATTATGAGAGCAATCAATGTAAATAAGCTTGTCGATGCAGGCTGTATT
TTCATTTTTTGGGTTGCTGACTGGTTCGCTTTACTTAACAATAAAATGGATGGTGATTTA
GATAAGATTAGAACAGTTGGTCGTTATTTTATTGAAACTTGGAAAGCTGCAGGAATGAAA
ATGCACAATGTTAAATTTTTATGGTGTTCTGACGAAATCAATAAGAAGTCAAACGATTAC
TGGCTTCAAGTCATAGATGTTGCTAGAAAGTTTAATATCACAAGAATGAAAAAATGTTCT
TAAATTATGGGAAGAGCCGAAAGTGATGAATTAGCTGTCTCCTAATTGTTATATCCTGCT
ATGTAATGCACAGATATCTTCCACTTAAAGGCTGACATTTGCTCTTTGGGTTTAGATTAA
CGTAAAGTTAATATGCTTGCAAGAGACTATGTTGCCAAGCCTGATAATAACTACAAACTT
CACACTCCTGTTATTGTTTCTCATCATATGCTTAGTGGTTTAAAAGAAGGATAAGCTAAA
ATGAGTAAAAGTGATCCTATGAGTGCAATTTTCATGGAAGATACTGAGGAAGATGTCAAC
AAAAAGATCGATGGTGCTTACTGCAAGCCCAAGGAAGTTTACTAAGAAGATGGTAAAACT
TTTGTTAATCCTATTATGGATTACACTAAAAGCATTGTATTTGGTGCTTTCAATAAAATT
GAACTTATCCGTAAACCCGAAAACGGTGGCAACATTACCTACAACACTTACGAATAACTT
GAACAAGATTACATTGAAGGAAAGGTACATCCTGGAGATTTGAAGGCTGCTGTTAAAATT
GCCCTTAACAAATTAATCCAACCTGTTCGTGATCATTTCTAGAATGACCCTGTTGCTAAG
CAACTATTATCTCAAATTAAATTATGGCAATAGTAGAAATTACAAAAAGAATAATAGTTG
TTGTTGCAATAATAAAAAGAAGCAGCTGCACAAGCTTAATGA


>TTHERM_00149980(protein)
MDTKINYLTGGLQFKLHDDIEEEVVQLKQNLQRMYKPIAPSVDLNAAFDPQPSKLSLKQR
FQLIKSFAEEIIQENELVKLLSTKQFPICYDGFEPSGRMHIAQGIMRAINVNKLVDAGCI
FIFWVADWFALLNNKMDGDLDKIRTVGRYFIETWKAAGMKMHNVKFLWCSDEINKKSNDY
WLQVIDVARKFNITRMKKCSQIMGRAESDELAVSQLLYPAMQCTDIFHLKADICSLGLDQ
RKVNMLARDYVAKPDNNYKLHTPVIVSHHMLSGLKEGQAKMSKSDPMSAIFMEDTEEDVN
KKIDGAYCKPKEVYQEDGKTFVNPIMDYTKSIVFGAFNKIELIRKPENGGNITYNTYEQL
EQDYIEGKVHPGDLKAAVKIALNKLIQPVRDHFQNDPVAKQLLSQIKLWQQQKLQKEQQL
LLQQQKEAAAQAQ


>TTHERM_00149980(gene)
ATGGATACAAAAATCAACTACTTGACTGGTGGATTGCAATTTAAGCTTCATGACGATATC
GAAGAAGAAGTAGTTTAGCTTAAATAAAATCTTTAAAGAATGTATAAACCAATAGCACCC
TCCGTAGATTTAAATGCTGCTTTTGACCCTTAACCCAGCAAGTATATATTAAATTATAAG
CATAAACGTTTAATAATTTTAAAAAGAAAAAATAACTAAAATTGCTAAAATTATTTCTCA
AATTACAAACTAAAATCATTTTAAGTGGACAATATTAATTTAAAAATTTTTATTAATAAT
AAAGGTTATCTTTGAAACAAAGATTCTAACTCATTAAGAGTTTTGCTGAAGAAATAATTC
AAGAAAATGAACTCGTAAAGTTATTATCTACAAAGCAATTCCCTATTTGCTATGATGGAT
TCGAACCATCAGGTAGAATGCACATAGCATAAGGTATTATGAGAGCAATCAATGTAAATA
AGCTTGTCGATGCAGGCTGTATTTTCATTTTTTGGGTTGCTGACTGGTTCGCTTTACTTA
ACAATAAAATGGATGGTAAATTTTTATAAAATACATGAAACCAAATAAACTATAAATCAA
ATGAAAAATCGATTGTTTTTATTTCCCTCAAGCTCATATTACTTTTATAAATTTAAGGTG
ATTTAGATAAGATTAGAACAGTTGGTCGTTATTTTATTGAAACTTGGAAAGCTGCAGGAA
TGGTAATAAGAATAAAAATAAAAAAGATTAATCTTTTTATTTAGTTTTTAGAGGAAAACA
AAGACAAATAAATTTTTTTTAAATATCTTAGAAAATGCACAATGTTAAATTTTTATGGTG
TTCTGACGAAATCAATAAGAAGTCAAACGATTACTGGCTTCAAGTCATAGATGTTGCTAG
AAAGTTTAATATCACAAGAATGAAAAAATGTTCTTAAATTATGGGAAGAGCCGAAAGTGA
TGAATTAGCTGTCTCCTAATTGTTATATCCTGCTATGTAATGCACAGATATCTTCCACTT
AAAGGCTGACATTTGCTCTTTGGGTTTAGATTAACGTAAAGTTAATATGCTTGCAAGAGA
CTATGTTGCCAAGCCTGATAATAACTACAAACTTCACACTCCTGTTATTGTTTCTCATCG
TAATTAAAATATTTAAAATTTTTAAATAATAATTTTAAAATTAATATTCTGTTTTTGCAA
CCCACCCACATAAAAAATATAAACTTATCTAATATTCTAATCTTGTTTTTTTATTTAAAT
GAATTAATTCTCTTAATCTAAAAATATAACTAAATTAACTTTTATATTTAGTAAATATGC
TTTAATTTTTAGATGAATTATATTTAATTTATCAAATAAAAATTTATCTTTTTTTGCTGA
ATATTTTTTTAAAATTAAGATATGCTTAGTGGTTTAAAAGAAGGATAAGCTAAAATGAGT
AAAAGTGATCCTATGAGTGCAATTTTCATGGAAGATACTGAGGAAGATGTCAACAAAAAG
ATCGATGGTGCTTACTGCAAGCCCAAGGAAGTTTACTAAGAAGATGGTAAAACTTTTGTT
AATCCTATTATGGATTACACTAAAAGCATTGTATTTGGTGCTTTCAATAAAATTGAACTT
ATCCGTAAACCCGAAAACGGTGGCAACATGTAAATTATAAATAAATTTAGAGATATTTTA
ATCATATTATTATACATATAGTACCTACAACACTTACGAATAACTTGAACAAGATTACAT
TGAAGGAAAGGTACATCCTGGAGATTTGAAGGCTGCTGTTAAAATTGCCCTTAACAAATT
AATCCAACCTGTTCGTGATCATTTCTAGAATGACCCTGTTGCTAAGCAACTATTATCTCA
AATTAAATTATGGCAATAGTAGAAATTACAAAAAGAATAATAGTTGTTGTTGCAATAATA
AAAAGAAGCAGCTGCACAAGCTTAATGA