Identifiers and Description

Gene Model Identifier

TTHERM_00047530

Standard Name

YRS1 (tyrosyl-tRNA synthetase 1)

Aliases

PreTt11232 | 3.m01854 | 3824.m02990

Description

TRNA binding domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00047530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01699.18.001476333098533e-119TRNA binding domain-containing
protein (195 aa)
OxytrichaContig15114.0.g231.0002335610448659e-38Putative tRNA binding domain
DictyBaseDDB_G02919268.99768837233868e-29DDB_G0291926 on chromosome: 6
position 959253 to 960582
Stentor CoeruleusSteCoe_85137.095474162284704e-23
WormBaseWBGene000034151.9991095569230066e-20locus:mars-1 status:Confirme
d UniProt:D3YT56 protein_i
d:CBK19453.1
SGDYGL105W1.000116773704384e-19ARC1 Protein that binds tRNA a
nd methionyl- and glutamyl-tRN
A synthetases (Mes1p and Gus1p
), delivering tRNA to them, st
imulating catalysis, and ensur
ing their localization to the
cytoplasm; also binds quadrupl
ex nucleic acids

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00047530(coding)
ATGGAAGTTTCAACTGCTGCAAATCAAACTGAAAATAATGCTGATAAAGCAACCTAAGTT
TAAAAGAAACCATTAAATAGTGCCTCTTTTGAAGAATTCTAAAAGATAGACATTCGTGTA
GGCAAAATTGTTGAATGTAAAATCCATCCAAGCAGCGACTATCTTTATTGCTTAAAAGTT
GATATAGGTACTGAAGTTAGAGACATAGGCTCTGGCTTATAGTAGTATATTCCTATTGAT
TAAGTAAATGGATTAGTTTGTGTTATGGCTAATCTTAAACCAAGAAAATTGGGAGGGTTT
GACTCTAATGGTATGATTCTTTGCACAAATATTGACACAAAAGCCTTCGAATTTTTAAGA
CCTCATGAGAACTCAGTTGTTGGTGAAAGAATCTTTTTAGAAGGTTAGCAAGAAAGTTTT
AAATAAGAATTAGAACCACAATTAAATCAAAAAAAGAAAATATTAGAAAGAGCATTATTA
GAAACAAAAACAGATGATGAGTGTGTAGCTACTTTTAAAAATGTAAAATGGATGACCAAA
TCTGGGTATGTTAAAGCAAAATCATTTAAGAATAGTCCTATTGATTGA


>TTHERM_00047530(protein)
MEVSTAANQTENNADKATQVQKKPLNSASFEEFQKIDIRVGKIVECKIHPSSDYLYCLKV
DIGTEVRDIGSGLQQYIPIDQVNGLVCVMANLKPRKLGGFDSNGMILCTNIDTKAFEFLR
PHENSVVGERIFLEGQQESFKQELEPQLNQKKKILERALLETKTDDECVATFKNVKWMTK
SGYVKAKSFKNSPID


>TTHERM_00047530(gene)
ATGGAAGTTTCAACTGCTGCAAATCAAACTGAAAATAATGCTGATAAAGCAACCTAAGTT
TAAAAGAAACCATTAAATAGTGCCTCTTTTGAAGAATTCTAAAAGATAGACATTCGTGTA
GGCAAAATTGTTGAATGTAAAATCCATCCAAGCAGCGACTATCTTTATTGCTTAAAAGTT
GATATAGGTACTGAAGTTAGAGACATAGGCTCTGGCTTATAGTAGTATATTCCTATTGAT
TAAGTAAATGGATTAGTTTGTGTTATGGCTAATCTTAAACCAAGAAAATTGGGAGGGTTT
GACTCTAATGGTATGATTCTTTGCACAAATATTGACACAAAAGCCTTCGAATTTTTAAGA
CCTCATGAGAACTCAGTTGTTGGTGAAAGAATCTTTTTAGAAGGTTAGCAAGAAAGTTTT
AAATAAGAATTAGAACCACAATTAAATCAAAAAAAGAAAATATTAGAAAGAGCATTATTA
GAAACAAAAACAGATGATGAGTGTGTAGCTACTTTTAAAAATGTAAAATGGATGACCAAA
TCTGGGTATGTTAAAGCAAAATCATTTAAGAATAGTCCTATTGATTGA