Identifiers and Description

Gene Model Identifier

TTHERM_00637810

Standard Name

YPK2 (Yeast Protein Kinase )

Aliases

PreTt19784 | 91.m00199

Description

Protein kinase domain containing protein. Sequence similarity to the AKT protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF00433 ) Protein kinase C terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00637810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03600.19.997093137033517e-262protein kinase domain-containi
ng protein (443 aa)
OxytrichaContig22319.0.g123.0008389609965914e-128Protein kinase domain
SGDYMR104C2.999977985165137e-107YPK2 Protein kinase with simil
arity to serine/threonine prot
ein kinase Ypk1p; functionally
redundant with YPK1 at the ge
netic level; participates in a
signaling pathway required fo
r optimal cell wall integrity;
homolog of mammalian kinase S
GK
DictyBaseDDB_G02686202.0005752503420762e-105pkbA on chromosome: 1 position
1977388 to 1978925
WormBaseWBGene000001021.0002434920975502e-91locus:akt-1 Serine/threonine
-protein kinase akt-1 status
:Confirmed UniProt:Q17941
protein_id:CAA98238.1
Stentor CoeruleusSteCoe_181705.665668176358939e-52

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00637810(coding)
ATGGGAAACGTTTGTCCAAGTGAAGCTAGCAAAAATAAGATTCAAAGATAAATTGATGAA
GACTAGAGTATTAATGGCAACAAAAAAACCAATAAAACTCTTGCTTCAGATGGGTAATTG
CAAACCGATAATGGAGTTCGTCATTCCTAAGAAGATGAGGAAGCAGAACCCGTTTGCATT
ATGTCACGTAAAAAAAATAAAAAAATTTCCGTAAAAGACTTTTAGCTAAAACAAGTATTA
GGAAAGGGGTCTTTCGGTAAAGTAGTTTTAGTTGAAAAAAAGGATACAAAGGAACTTTAT
GCCATGAAAATCTTGAAAAAAGACTACATTTAATATACAAATCAGAAGTTTAATACATAG
CAAGAAAGAGATATTTTGGTTAAGATGAACTCACCATTTATTGTAAAGCTTCATTATGCC
TTCTAAACAGCTGATAAGCTCTATATAGTTATGGATTTTATGATTGGCGGAGAATTGTTT
TACCATCTCAGAAGATCTCCTATTTTCACAGAAGAAAAAGCCGCTTACTACTCAGCTGAA
ATCATTTTAGGTATAGAAGCTCTCCACAGCAATAATATCATCTATAGAGATTTAAAACCC
GAAAATATTTTAATAGATCACAAAGGCCATTTGCGTTTGGCAGATTTTGGGCTTTCTAAA
AAGGGAGTAAAAGATCACGAGAGAACTAATAGTTTATGTGGTACACCTGAATATTTGGCT
CCAGAGATACTATTAAATAATGGCCACACAAAAATGGTTGATTGGTGGAGTTTGGGAGCT
ATCATCTACGAAATGCTAACTGGTGCTCCTCCATTCTATAACAAAAATTAAAAGCAGATG
TTTAAAGATAGATTTTTGAAGCCTATAGAAATGAAAGAGTGGTTCTCTCCAGCAGCTAAA
TCCTTGTTATCAGGTTTATTAAATATAAATCCTGAATTAAGATTAGGATTCAAAGGAATT
TAAGAAATTAAAGAGCATGAATTTTATGCAAGTATAAATTGGGATAAGCTATATAAAAAA
GAAATTCCACCTCCATACAAGCCTAAACTTTCAAGCAAGTATGACTTAAGCCATTTTTCA
AAATAATTTACAACTGAAACTGTAAAGGACACACCATATTGTGGTAAAACTATCAAAGAT
TCATATAATGATTTCACTTATTAAAGAAACGATATAAATTCTGCTGCTTTAAAATCATAA
ATGGTAAGTCGTATTAGAGATGAAGTTCCAACTAAAATTGAAGAAGAGAAGAAATCTCTA
AATAACGAAATAACTACAGAAAGTAATCTAAATCAACCTCTAATTAATAAATGA


>TTHERM_00637810(protein)
MGNVCPSEASKNKIQRQIDEDQSINGNKKTNKTLASDGQLQTDNGVRHSQEDEEAEPVCI
MSRKKNKKISVKDFQLKQVLGKGSFGKVVLVEKKDTKELYAMKILKKDYIQYTNQKFNTQ
QERDILVKMNSPFIVKLHYAFQTADKLYIVMDFMIGGELFYHLRRSPIFTEEKAAYYSAE
IILGIEALHSNNIIYRDLKPENILIDHKGHLRLADFGLSKKGVKDHERTNSLCGTPEYLA
PEILLNNGHTKMVDWWSLGAIIYEMLTGAPPFYNKNQKQMFKDRFLKPIEMKEWFSPAAK
SLLSGLLNINPELRLGFKGIQEIKEHEFYASINWDKLYKKEIPPPYKPKLSSKYDLSHFS
KQFTTETVKDTPYCGKTIKDSYNDFTYQRNDINSAALKSQMVSRIRDEVPTKIEEEKKSL
NNEITTESNLNQPLINK


>TTHERM_00637810(gene)
ATGGGAAACGTTTGTCCAAGTGAAGCTAGCAAAAATAAGATTCAAAGATAAATTGATGAA
GACTAGAGTATTAATGGCAACAAAAAAACCAATAAAACTCTTGCTTCAGATGGGTAATTG
CAAACCGATAATGGAGTTCGTCATTCCTAAGAAGATGAGGAAGCAGAACCCGTTTGCATT
ATGTCACGTAAAAAAAATAAAAAAATTTCCGTAAAAGACTTTTAGCTAAAACAAGTAATT
AATATTCAATTTTATTTTTTCATAATTTAATTTGATTATTCTTACTAAAGTCTTTTTATT
GGTTTGATTCGACTTTACAAATACCCACAAAAACATTTCCTCTATATATAAATTAATGTA
AATTTTCAAAAACTAGATAAATAGCAATATAAAAACAAAAGACTATATTAATTTATAAAT
GCTTGTTTTTCCAATGATTTTGTTATTTATTATTTATTTAGTTTGCAAATATTATTATCT
AGTTATTAAGACTTTCGGCATACATGTACTTATCAAAAAAAAGCCAAACTTCTATTTCCA
AATAATAGTGATAATATTCTTTTTATAAATTTTAGGTATTAGGAAAGGGGTCTTTCGGTA
AAGTAGTTTTAGTTGAAAAAAAGGATACAAGTAAATTGATTTTTATTTGATGAAACCCAC
ATAGGCATTTAGAGCTTATTTTATGAGAATAAATATCTCATCTAATCTTATTATTTCTAA
AAATTTAATAGAGGAACTTTATGCCATGAAAATCTTGAAAAAAGACTACATTTAATATAC
AAATCAGAAGTTTAATACATAGCAAGAAAGAGATATTTTGGTTAAGATGAACTCACCATT
TATTGTAAAGCTTCATTATGCCTTCTAAACAGCTGATAAGCTCTATATAGTTATGGATTT
TATGATTGGCGGAGAATTGTTTTACCATCTCAGAAGATCTCCTATTTTCACAGAAGAAAA
AGCCGCTTACTACTCAGCTGAAATCATTTTAGGTATAGAAGCTCTCCACAGCAATAATAT
CATCTATAGAGATTTAAAACCCGAAAATATTTTAATAGATCACAAAGGCCATTTGCGTTT
GGCAGATTTTGGGCTTTCTAAAAAGGGAGTAAAAGGTAAAAATTTATTATAAGTTAAATA
CAAAAATATAAATCTGTTTTCCTTTCTAATATTGCTTCTAAAATAAGCAAGCAAGCAACT
CTATCAGAAAGAATGAATTAGCAATATTAAATGATTTTTTTAACAATTATTTTAAATCTA
AATTAGATCACGAGAGAACTAATAGTTTATGTGGTACACCTGAATATTTGGCTCCAGAGA
TACTATTAAGTAAATTCAAGTTTTAATATTGCTAGATAAAAATGTATTTTTATATTTAAT
TAAGATAATGGCCACACAAAAATGGTTGATTGGTGGAGTTTGGGAGCTATCATCTACGAA
ATGCTAACTGGTGCTCCTCCATTCTATAACAAAAATTAAAAGCAGATGTTTAAAGATAGA
TTTTTGAAGCCTATAGAAATGAAAGAGTGGTTCTCTCCAGCAGCTAAATCCTTGTTATCA
GGTTTATTAAATATAAATGTAAGCTAAATAATTTCCAATACTATTAAATTCATAAATTTT
TCCTATCAAATAGCCTGAATTAAGATTAGGATTCAAAGGAATTTAAGAAATTAAAGAGCA
TGAATTTTATGCAAGTATAAATTGGGATAAGCTATATAAAAAAGAAATTCCACCTCCATA
CAAGCCTAAACTTTCAAGCAAGTATGACTTAAGCCATTTTTCAAAAGTAAATAATTTATA
AATTGATTTAATTTTTGAATTTATTTTTAATAAAAAATTTATCTAATTTACAATTTATTC
CTAAAATAAAAAGTAATTTACAACTGAAACTGTAAAGGACACACCATATTGTGGTAAAAC
TATCAAAGATTCATATAATGATTTCACTTATTAAAGGTAATCAATTTATTATTAAAATAC
CATTTTATAATAATTTAAATTCTTATCAAAAGAAACGATATAAATTCTGCTGCTTTAAAA
TCATAAATGGTAAGTCGTATTAGAGATGAAGTTCCAACTAAAATTGAAGAAGAGAAGAAA
TCTCTAAATAACGAAATAACTACAGAAAGTAATCTAAATCAACCTCTAATTAATAAATGA