Identifiers and Description

Gene Model Identifier

TTHERM_00046390

Standard Name

YNG1 (Yeast homolog of mammalian Ing1 )

Aliases

PreTt11118 | 3.m01708 | 3824.m02880

Description

Subunit of the NuA3 histone acetyltransferase complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00046390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01808.19.997093137033517e-262PHD-finger family protein (833
aa)
OxytrichaContig94.1.g740.0000000000009003435339752751hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00046390(coding)
ATGAGCTAGAGTGAGATAGAGAGCCACAATAAATAATAAGAATAACTGTAAAAACATGAT
AATAATGACTTCATGCAAAATAATAATCGTTCATCATAAAATTAAGCTTAGGAATAACAC
TAAGTAGATAAAAATTAAAATAGAAATGGATCTGCAAATGCGCAAAATAATTATTCAAAC
TAACAAAATTTGTAATAAAACAAATATGTATCTAAATATTAAGAATTCGAAGAAAGAAGC
GATTATGTTACTTTGTTTAATTTTGATGAAAATTCGAGAGTCTATCCTTTCTTAACATCC
CCACGATCTAAAGAGGCATGCTTGAGATAAGGCGTTGAAGAGTATTAGCTTTTAAAGAAA
ACAAAGAAAGACTTTGAAAAAGAATAAATCCCTAATGAATTTAAGGATGATCCTGAGTTT
TATATAAATCTTAAAGCTGAGAAGTACGAAAAGAGAAGATAAGAGAGAATACTACAAGTT
TAATAGGAAAGGGATAATATAATTTAAGAATAAAAGAGAGATAGTTAGTTTTAGAGATAA
AGCTTTTACAAATCTTAAGGTGGAGAAAGTTCTTAAACAAATTTAACTCCTACTTAGGAG
TAAGAAAAGTTAAAGCTCTAAGTATTAAAAAAAAAGCAAGAATAATAAATAGAATTTTTG
TTAGAAAATTAAAGGAAGCAATAGGAAATAATGGAAAAATAAGAATAGAAAGAATTGAGA
GTATTAGAAATGGAAAGAAGGAAGTAATTAGAGTTTGAAAGAAAGAGGTAAGAAGCTGAA
GAAGCTGAAAGACATAGACTAAGTAAAAAGCAAGAAGCTGAAAAAATCTAGCAATTAAAG
GCTGGAGAACTTTTAGATAGATATTAAGAAGCAGATTTAAAAATTAAAATTAAAAATGAA
TAACTGTAAAGGTAGAGAGAACAGGAGCAGATAAAACGAGAAGTAGAAAGAAAACACAAG
ATGGAATCTATATAGGCAAAAATATAATATTTAACAGCAGAAAAAAAAGAATAGATAGAG
TAACGTAAGTAGGAAAGAGAGATAAAACTATCAAAAGTCGAGCAATAAAAGCATGAGGAA
TTAGTAGAGAGAATGAAGAAAATGAGAGAAAAAGAAGAAGAGCACAGAATTAAATTAGAA
TAGTAAAAGGTTGAGGAAATTAGGCAGAAATAACTTGTGAAACAAAAATATGACGAAAAA
TTATATGAAACAGAATAAAAAAGACTTTATGATTAGCAAGTTTAAGAATAGCAATTGTAA
AATAGAGTTATAGTTAGGATGGAAAAAGAAAGAATAATTAAGAAATAACTTTCATAGAAT
TTCAAGGAAGAGTAAGCTAATAAAAAGAAGTTACTTTAAAGATTTGAAGAAAAATAGCAA
TAACTTGAATATTAAAGAATGAAAAGACTTGAACAAATAATGGAAAGAAAAAAATCATAA
GAGTAGCATTAATAAGAGGTTTTAGACAGAAATAGGAGAAGTGTTTAGTAGATTAATTTA
GAGAATAAAACATTTTTATATGAGCTAGAGAGAAAAACAATAATCGTTAATGAAAACAGA
TAGTCAAATATTAACCAATTAAGAAAGAGGGTAGCATTAGAACTACTTAAGATTGAAGAA
GCAAAAGAAAACTAAGAAAGAGTAGAGAAAATGAGAGCTTATTAAAAGCAAAAACTTTTG
AATAAATTGCATGAAGATTAAATCAGAATAGAAATGTAATAAAAAGAAAAGGAAGAATAA
AAAAGGAACAGAGAAAATTTCAAAAAGTAATTAAATGATGAAAAACAAAGATTAGTAAAA
CAATTTGCTTTAGAATTAGAGTCTTTGAAAAACTCTAAAAAGGAGTCCTTCATGTAAAGC
CATTCTTAAACTGTAAAAAACTTGAATTCATCTCATTACGAAAACAGTTAAACTTCTTCT
CAATTTATTCAACATAAAAAAAACAAATACAATACTCATTCTCATTCTCAAGAAAATATT
CATTAAAACAACTAACAAATTGAAAGCAAATCAAAGCACCACAAAAAAAATCAAGGAAGT
GTATCTAAAAGTAATTAGTAGCATTAATATTTAGAAGTCCAGAATACTACATAAAATGAA
TGCTAGATTTAAGAAGATAAAAAATAAAATGAATAAGAAGGACAGAACAATGGGGAAACA
CAATAAGTACAATAAGGAAATTTAGAAAATTTATCTTAAATAAAACCTCACAAAACTAAC
AATAATTAATAGCATACTTAAGAGCTTAATAAGTCTTTATAATCAAATATATCTCCTTCA
CCTTAAAGACTATAATACTTGAATGCCTCATTTTCTAATCCAAAAGTCAAAGCTTATGGA
AGAGATATTACAAAAGAAAAGTTAAAGCTGTTAATTGAATATGAAAAATAAAATAGTATA
GAATATAGTAAAACAAAGAAAGCTGGTAAAAAGAAAAATATCAAAGTAGAACTTAGTTCT
ACTTTTTCTGTCCTAAGACAAAATCAAATTGATGAGATAAACGAAAATCTTAATTTTTGG
AGTTAGGCTACTGAAAATATTTTGAAAGACTTTCTTAATCAGCAAAAAGATCATTAAAAT
AATAGTGAGGTTGCTTAACTTAGTGAAAAGCTTATCAATTTATATTAGAGCTAAATAAGT
GCAGATAAGTAACAAAGAAAATAAATAAATTATTTAGGGCTTTTTAAATGA


>TTHERM_00046390(protein)
MSQSEIESHNKQQEQLQKHDNNDFMQNNNRSSQNQAQEQHQVDKNQNRNGSANAQNNYSN
QQNLQQNKYVSKYQEFEERSDYVTLFNFDENSRVYPFLTSPRSKEACLRQGVEEYQLLKK
TKKDFEKEQIPNEFKDDPEFYINLKAEKYEKRRQERILQVQQERDNIIQEQKRDSQFQRQ
SFYKSQGGESSQTNLTPTQEQEKLKLQVLKKKQEQQIEFLLENQRKQQEIMEKQEQKELR
VLEMERRKQLEFERKRQEAEEAERHRLSKKQEAEKIQQLKAGELLDRYQEADLKIKIKNE
QLQRQREQEQIKREVERKHKMESIQAKIQYLTAEKKEQIEQRKQEREIKLSKVEQQKHEE
LVERMKKMREKEEEHRIKLEQQKVEEIRQKQLVKQKYDEKLYETEQKRLYDQQVQEQQLQ
NRVIVRMEKERIIKKQLSQNFKEEQANKKKLLQRFEEKQQQLEYQRMKRLEQIMERKKSQ
EQHQQEVLDRNRRSVQQINLENKTFLYELERKTIIVNENRQSNINQLRKRVALELLKIEE
AKENQERVEKMRAYQKQKLLNKLHEDQIRIEMQQKEKEEQKRNRENFKKQLNDEKQRLVK
QFALELESLKNSKKESFMQSHSQTVKNLNSSHYENSQTSSQFIQHKKNKYNTHSHSQENI
HQNNQQIESKSKHHKKNQGSVSKSNQQHQYLEVQNTTQNECQIQEDKKQNEQEGQNNGET
QQVQQGNLENLSQIKPHKTNNNQQHTQELNKSLQSNISPSPQRLQYLNASFSNPKVKAYG
RDITKEKLKLLIEYEKQNSIEYSKTKKAGKKKNIKVELSSTFSVLRQNQIDEINENLNFW
SQATENILKDFLNQQKDHQNNSEVAQLSEKLINLYQSQISADKQQRKQINYLGLFK


>TTHERM_00046390(gene)
GCGTATCTAATAAATTTGTAATTAATTCAATTGATATTTGTAATTAAGTAAAAAATGAGC
TAGAGTGAGATAGAGAGCCACAATAAATAATAAGAATAACTGTAAAAACATGATAATAAT
GACTTCATGCAAAATAATAATCGTTCATCATAAAATTAAGCTTAGGAATAACACTAAGTA
GATAAAAATTAAAATAGAAATGGATCTGCAAATGCGCAAAATAATTATTCAAACTAACAA
AATTTGTAATAAAACAAATATGTATCTAAATATTAAGAATTCGAAGAAAGAAGCGATTAT
GTTACTTTGTTTAATTTTGATGAAAATTCGAGAGTCTATCCTTTCTTAACATCGTAATAT
TTGAATTAAGCAATTTTATATATTGAAAAATTTTAAACAATTAAATCTATTCATATTATT
TGCATATTATAAAAGCCCACGATCTAAAGAGGCATGCTTGAGATAAGGCGTTGAAGAGTA
TTAGCTTTTAAAGAAAACAAAGAAAGACTTTGAAAAAGAATAAATCCCTAATGAATTTAA
GGATGATCCTGAGTTTTATATAAATCTTAAAGCTGAGAAGTACGAAAAGAGAAGATAAGA
GAGAATACTACAAGTTTAATAGGTAAATATATAAATTACTTGTTAGTTAGTATAAACATT
TATTTATAATAAGGAAAGGGATAATATAATTTAAGAATAAAAGAGAGATAGTTAGTTTTA
GAGATAAAGCTTTTACAAATCTTAAGGTGGAGAAAGTTCTTAAACAAATTTAACTCCTAC
TTAGGAGTAAGAAAAGTTAAAGCTCTAAGTATTAAAAAAAAAGCAAGTAAATATAAGCAA
TTTTGATGATTTATAATAATTTTTAAAATACTATGATAATAATAAATAGGAATAATAAAT
AGAATTTTTGTTAGAAAATTAAAGGAAGCAATAGGAAATAATGGAAGTAATTTATTTATT
TTAATGAGTTTCTTTTTTTAAAGTCTGTTTTTAAATAGAAATAAGAATAGAAAGAATTGA
GAGTATTAGAAATGGAAAGAAGGAAGTAATTAGAGTTTGAAAGAAAGAGGTAAGAAGCTG
AAGAAGCTGAAAGACATAGACTAAGTAAAAAGCAAGAAGCTGAAAAAATCTAGCAATTAA
AGGCTGGAGAACTTTTAGATAGATATTAAGAAGCAGATTTAAAAATTAAAATTAAAAATG
AATAACTGTAAAGGTAGAGAGAACAGGAGCAGATAAAACGAGAAGTAGAAAGAAAACACA
AGATGGAATCTATATAGGCAAAAATATAATATTTAACAGCAGAAAAAAAAGAATAGATAG
AGTAACGTAAGTAGGAAAGAGAGATAAAACTATCAAAAGTCGAGCAAGTAAAATAGATTA
AAACTTATATAGTTATTTAATATTATTATTTATTAGTAAAAGCATGAGGAATTAGTAGAG
AGAATGAAGAAAATGAGAGAAAAAGAAGAAGAGCACAGAATTAAATTAGAATAGTAAAAG
GTTGAGGAAATTAGGCAGAAATAACTTGTGAAACAAGTAAAATTATAATATCATTTTAAG
TAGTGTAATTTTTATATTTATTTAGAAATATGACGAAAAATTATATGAAACAGAATAAAA
AAGACTTTATGATTAGCAAGTTTAAGAATAGCAATTGTAAAATAGAGTTATAGTTAGGAT
GGAAAAAGAAAGAATAATTAAGAAATAACTTTCATAGAATTTCAAGGAAGAGTAAGCTAA
TAAAAAGAAGTTACTTTAAAGATTTGAAGAAAAATAGCAATAACTTGAATATTAAAGAAT
GAAAAGACTTGAACAAATAATGGAAAGAAAAAAATCATAAGAGTAGCATTAATAAGAGGT
TTTAGACAGAAATAGGAGAAGTGTTTAGTAGATTAATTTAGAGAATAAAACATTTTTATA
TGAGCTAGAGAGAAAAACAATAATCGTTAATGAAAACAGATAGTCAAATATTAACCAATT
AAGAAAGAGGGTAGCATTAGAACTACTTAAGATTGAAGAAGCAAAAGAAAACTAAGAAAG
AGTAGAGAAAATGAGAGCTTATTAAAAGCAAAAACTTTTGAATAAATTGCATGAAGATTA
AATCAGAATAGAAATGTAATAAAAAGAAAAGGAAGAATAAAAAAGGAACAGAGAAAATTT
CAAAAAGTAATTAAATGATGAAAAACAAAGATTAGTAAAACAATTTGCTTTAGAATTAGA
GTCTTTGAAAAACTCTAAAAAGGAGTCCTTCATGTAAAGCCATTCTTAAACTGTAAAAAA
CTTGAATTCATCTCATTACGAAAACAGTTAAACTTCTTCTCAATTTATTCAACATAAAAA
AAACAAATACAATACTCATTCTCATTCTCAAGAAAATATTCATTAAAACAACTAACAAAT
TGAAAGCAAATCAAAGCACCACAAAAAAAATCAAGGAAGTGTATCTAAAAGTAATTAGTA
GCATTAATATTTAGAAGTCCAGAATACTACATAAAATGAATGCTAGATTTAAGAAGATAA
AAAATAAAATGAATAAGAAGGACAGAACAATGGGGAAACACAATAAGTACAATAAGGAAA
TTTAGAAAATTTATCTTAAATAAAACCTCACAAAACTAACAATAATTAATAGCATACTTA
AGAGCTTAATAAGTCTTTATAATCAAATGTATCATACTCTAATTTATTTAATAGTTATTA
ATCAATACTTTTTTATAAATAGATATCTCCTTCACCTTAAAGACTATAATACTTGAATGC
CTCATTTTCTAATCCAAAAGTCAAAGCTTATGGAAGAGATATTACAAAAGAAAAGTTAAA
GCTGTTAATTGAATATGAAAAATAAAATAGTATAGAATATAGTAAAACAAAGAAAGCTGG
TAAAAAGAAAAATATCAAAGTAGAACTTAGTTCTACTTTTTCTGTCCTAAGACAAAATCA
AATTGATGAGATAAACGAAAATCTTAATTTTTGGAGTTAGGCTACTGAAAATATTTTGAA
AGACTTTCTTAATCAGCAAAAAGTATTTTTTTTTAACTTAATTTAAAAATCATTAAACTA
AATTTAATTAAATAGGATCATTAAAATAATAGTGAGGTTGCTTAACTTAGTGAAAAGCTT
ATCAATTTATATTAGTATAGTTATTAGTAAATTAACATTATTTTAAATACTTTTTTCAAA
ATATTAGGAGCTAAATAAGTGCAGATAAGTAACAAAGAAAATAAATAAATTATTTAGGGC
TTTTTAAATGA