Identifiers and Description

Gene Model Identifier

TTHERM_00561450

Standard Name

YAF9

Aliases

PreTt27906 | 74.m00183 | 3720.m00073

Description

Member of the SWR complex. YEATS family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00561450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16137.16.999272261191859e-174YEATS family protein (374 aa)
OxytrichaContig5038.0.g1032.998577119979921e-31YEATS family
DictyBaseDDB_G02795639.995528898049344e-31DDB_G0279563 on chromosome: 3
position 2264498 to 2265670
SGDYNL107W6.997498932278805e-30YAF9 Subunit of both the NuA4
histone H4 acetyltransferase c
omplex and the SWR1 complex, m
ay function to antagonize sile
ncing near telomeres; interact
s directly with Swc4p, has hom
ology to human leukemogenic pr
otein AF9, contains a YEATS do
main
WormBaseWBGene000015852.000620012690291e-23locus:gfl-1 status:Confirmed
UniProt:Q21501 protein_id
:CAB01234.1
Stentor CoeruleusSteCoe_170143.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00561450(coding)
ATGCAACTCAATACTTAGCTAAAATAGCAAACATTTTCAAAGCCTATAGTTTATGGAACT
ATATCTTATTCATTAGGAGCAAATAAAAAATAAACTGACAAAAATACTCATAGATGGTGC
GCTTATGTTAGAGGTCCTAACAACGAAGATTTATCTACTTTCATTGATAAGGTAGTTTTT
GTACTTCATGAGACTTTTACTGATCATCAGAGAGCTATTACAAAACCTCCATTTGAAGTA
GTAGAAAAAGGTTGGGGTGAATTCGATATATTAATTTAAATCCACTTTAAAACTCATTAT
CCTTAGCTCGAGCTTGTCCATAAACTCAAATTTTATGGAGCTAAATCTGGAGGTAATTCT
TAAAGTACAAAGAAGCCTGTTGTTTCAGAATTCTATGATGAAATAGTCTTTGTTAATCCC
AGCGTTGAATTTTATGATATGTTAAGAGTTGAGAAATATTTATAAAATGAAGAAAAGCTC
TCAAAGGAGTCAAAGGGTGAAGGTGATAATGCATAAATGGAAGAAGAGTAGCCAGCTGAA
AAAGAAGAAGAAGAATATTATGATTGGAAATAGCACTACTTGAAATTTGATGCTTAAGAT
CACAAGTAAAAGTTAGATGACGCTTTAGTAGTTATAAAAGAACAAAATGAAAAAACAAAA
ATGGATTTAGAAAAGTGTGATAAAGATATTGAAGCATTAAACAAGGAAATTGAATAATTA
TAAAAAGAACAAGATTTAAAATAAAAGAAGCTCTTAGAGGAATAGCAATTACAATAGCAA
TAATAATAGTAATAATCTTAGGATGGAAATTAATTCTCATATCCAACTCCTAATTTCTAA
AACCCATAAAGTTAATCACAAATAAATGAATTCCCTAACGAATAGATTAGAAGCATACCT
TCTACTCCTTCAAATATCCAACAACAACCTCCCAACATACCTATTTAAAACATAGCTCCT
CCACCTCAAATGCAAAACTAATATAATCCTCCAAATTAGTATCCAATGGGATAACCACCT
GCAGCTCCCATGCCATAATAATAAGGACCTCCTCCTCCTTTAAACATGATGCCAAATAGT
TATGCTCCTCCTAATCCAAATATTAAAATGAATAACCCATATCAATAACCACCACCCAAT
ATGCCTATGTGA


>TTHERM_00561450(protein)
MQLNTQLKQQTFSKPIVYGTISYSLGANKKQTDKNTHRWCAYVRGPNNEDLSTFIDKVVF
VLHETFTDHQRAITKPPFEVVEKGWGEFDILIQIHFKTHYPQLELVHKLKFYGAKSGGNS
QSTKKPVVSEFYDEIVFVNPSVEFYDMLRVEKYLQNEEKLSKESKGEGDNAQMEEEQPAE
KEEEEYYDWKQHYLKFDAQDHKQKLDDALVVIKEQNEKTKMDLEKCDKDIEALNKEIEQL
QKEQDLKQKKLLEEQQLQQQQQQQQSQDGNQFSYPTPNFQNPQSQSQINEFPNEQIRSIP
STPSNIQQQPPNIPIQNIAPPPQMQNQYNPPNQYPMGQPPAAPMPQQQGPPPPLNMMPNS
YAPPNPNIKMNNPYQQPPPNMPM


>TTHERM_00561450(gene)
AGAATCTTAATAGATAGATACATATCATTTTAAGTTAGGTAAATAAATATATAGATAATA
GCTAGCTAGATAGATAAAATGCAACTCAATACTTAGCTAAAATAGCAAACATTTTCAAAG
CCTATAGTTTATGGAACTATATCTTATTCATTAGGAGCAAGTAAAAATTTACTTTAGTGC
ACTAAATAAAAATATTAAATGGAGCTTTTGTTATTTTTTAGCATTTGAAATTAATATTTA
CCAACAAGAATGATTTAGAAAATGTCTTAAATAATTATTTGTCTTTAAATTAGATAAAAA
ATAAACTGACAAAAATACTCATAGATGGTGCGCTTATGTTAGAGGTCCTAACAACGAAGA
TTTATCTACTTTCATTGATAAGGTAGTTTTTGTACTTCATGAGACTTTTACTGATCATCA
GAGAGGTAAAAATTTAATTTAAAAAATCACAAACAAGCTGAAAATATTTTTTGAAATTAG
CTATTACAAAACCTCCATTTGAAGTAGTAGAAAAAGGTTGGGGTGAATTCGATATATTAA
TTTAAATCCACTTTAAAACTCATTATCCTTAGCTCGAGCTTGTCCATAAACTCAAAGTAT
ACTTATTCATTTTAAACAAAAGTAAATTTATTGATTTCAAAACAGTTTTATGGAGCTAAA
TCTGGAGGTAATTCTTAAAGTACAAAGAAGCCTGTTGTTTCAGAATTCTATGATGAAATA
GTCTTTGTTAATCCCAGCGTAAATTGCGTTTAATTTATCTAAAAAGAATTCAATAACTTA
AAAGATATCCTTTGTTCTAAGAGATAAAGGATACTATCCAAAAACTTAACCAAGATGATT
CATTCATTCATTTTGATTTTAATACAAACTAAATACACAAACTATATTAGAGTTTATTTG
CTTATTCAAAAATTTGATTGTTAAAAATAGGTTGAATTTTATGATATGTTAAGAGTTGAG
AAATATTTATAAAATGAAGAAAAGCTCTCAAAGGAGTCAAAGGGTGAAGGTGATAATGCA
TAAATGGAAGAAGAGTAGCCAGCTGAAAAAGAAGAAGAAGAATATTATGATTGGAAATAG
CACTACTTGAAATTTGATGCTTAAGATCACAAGTAAAAGTTAGATGACGCTTTAGTAGTT
ATAAAAGAACAAAATGAAAAAACAAAAATGGATTTAGAAAAGTGTGATAAAGATATTGAA
GCATTAAACAAGGAAATTGAATAATTATAAAAAGAACAAGATTTAAAATAAAAGAAGCTC
TTAGAGGAATAGCAATTACAATAGCAATAATAATAGTAATAATCTTAGGATGGAAATTAA
TTCTCATATCCAACTCCTAATTTCTAAAACCCATAAAGTTAATCACAAATAAATGAATTC
CCTAACGAATAGATTAGAAGCATACCTTCTACTCCTTCAAATATCCAACAACAACCTCCC
AACATACCTATTTAAAACATAGCTCCTCCACCTCAAATGCAAAACTAATATAATCCTCCA
AATTAGTATCCAATGGGATAACCACCTGCAGCTCCCATGCCATAATAATAAGGACCTCCT
CCTCCTTTAAACATGATGCCAAATAGTTATGCTCCTCCTAATCCAAATATTAAAATGAAT
AACCCATATCAATAACCACCACCCAATATGCCTATGTGA