Identifiers and Description

Gene Model Identifier

TTHERM_00663830

Standard Name

XRN3 (5'-3' exoribonuclease 3)

Aliases

PreTt23830 | 98.m00173 | 3736.m00071

Description

XRN 5'-3' exonuclease N-terminus family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF07609 ) conserved hypothetical protein
  • ( PF03159 ) XRN 5'-3' exonuclease N-terminus

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00663830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17204.19.997093137033517e-262XRN 5-3 exonuclease (841 aa)
OxytrichaContig14644.0.g341.9997677415930956e-65XRN 5-3 exonuclease N-terminus
WormBaseWBGene000069641.9990871925214856e-61locus:xrn-2 5-3 exoribonucle
ase 2 homolog status:Partial
ly_confirmed UniProt:Q9U299
protein_id:CAB54449.2
SGDYOR048C1.0001055852164665e-60RAT1 Nuclear 5 to 3 single-str
anded RNA exonuclease, involve
d in RNA metabolism, including
rRNA and snRNA processing as
well as poly (A+) dependent an
d independent mRNA transcripti
on termination
DictyBaseDDB_G02761372.9997246065828143e-59xrn1 on chromosome: 2 position
6232603 to 6238286
Stentor CoeruleusSteCoe_175182.8625185805493937e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00663830(coding)
ATGGGTGTACCAGGCTATTTTAGTTGGATTCACAGAAAGTATCCTTATCAAGTCAGAAAA
GTTAGACGCAACGGAAGAAAGAAACACATCGACTGCCTTTACATAGATGTAAACGGTATT
TGCTACTAATACGCTAGAGATGAGCACCAATATAACTATTTACTCAAACCTAAATCTCTT
GAAACTATATTTAAGCAAGTCATTGATCACATCGACTCAATTATCGAACTAGTAGAGCCT
TAGCTCTAAGTTTATCTTATGTTAGATGGTCCATGCCCAAGAGCAAAGATGAACTAGCAA
AGACAAAGAAGATTCCATGCTGAAATGCATCATTTAACATTGAAGGATGAGCTCAAAAAG
CATGGATTTGATGTGAAGGAAGAAACCGTACCAAATAATTCAATTGCTCCAGGAACTCCT
TTTATGTATGAACTAAATGAGTAGTTAAGGAGATATATTGAAACTCGTATTGCTTTATCT
AACAAAGCTATGACTGATGGAGAAGCAGATCATAAAGAGCATTAGGTAAGTTACAAGAAG
CTCTAATTTATCTTGAGTGATAGTAATGCTCCTGGCGAAGGTGAACATAAAATCCTTGAA
GTAATCAGAAAACATACTAATTTGTAGCTCACACATTGTATTGTTGGAGCTGATGCAGAT
TTACTCCTCCTTTCTCTTGCAACAATTGGCAAGCGTATTTTGATTTTAAGAGAAAACTCA
AAATTTAAAGGAGATAAGACAGATCTCGAAAAAGAATTATAGAAGCTTAAGGAAGAACTT
AGTCATCCACAATTAGACTTGCACAAAGAAAGAGAGTACGATTTAGTTGACATTAATGGA
TTGAAGAGAGTAATTCTTGATAAGTATAAGAAAATGTTTGACAATAAACAAGTATAGAAT
CTAAAATATAATCCTATGTCTCTTATGGATGATTTTGTCTTTTTAAGTTTATTCGCTGGT
AATGACTTCCTTCCTCGTTAGAATTACATGCAAATTAAATCAGAAAAAGGACATAAACCT
AACATTTTAGACAAGCTTATCGAAAAATATGATAGCTATCTTGAGACTGCTACAAGTTAT
CTTAGTGATAGAGGTTTTATTAAATACAATTAAATCATAGAATTTTTTAAGCAAGTAGCC
ACTATTGAGCCTAAATTCAAGAATAATAGAATTTTCGAAGCTCCTTAAAAAGAAGAGAAA
TCGGTCTTTGATTACGTCAAAATTATGAGTTAGAAGTAAATCAATAACGTTGAAGATATT
AAGGATTAGGATTTGATTGATTACGATTTCAAAGAAGAAGACCTTAAATTATAATAGACC
AGCTCTGTAAATGAAGAAACAGAAATCCCTAAGGATATTATTCCTATTTCTGATAGCGAT
GAAGATTAGGAGGAATAAAAATAAAGCCATGATAAAGAATATCACAAAAAAAATAAAAAG
GAATAGAAAAAGCATCACAATCAACATGATAAGGATAATTAATTAGCAAGTGGAACTGAA
GATGAATAGAAAAAGTAAAAGTAGAATCAAGAAGATGATGAAGAAGATGAAATTCAGAAA
ATATTGAGTGATGAAATGAATGGTAAAGAAATTTATTTGAAAGAAAAACTAAAAGTGACG
AATTAGTAAGAATATGATTTAATTATCATGAAATATCTTGAAGGTTTTGAATTCACCCTT
CTTTACTATTTCCGTGGTATTGAGAAAGCTTCATGGAATTACTTTTACCCTCACTATTAT
GCTCCTTTAACTCAAGATGTTGTTGAATTCTTAGAAAGAAATCCTAAATTTGAAGTTAAA
TTTGTCAAAACTCAGCCATTCTAACCTTACAAGCAACTTTTAGCTATTCTTCATCCAGAC
AATGAAGCCCTCTTACCTGCCGAATTCAAAGGTTTATTTAAAAAATATCTACAACCTTTT
TGCCCTTAAATTTTAGATATTGATAAGTATGGAGCTACTATGGAGCATATGTAAATTATA
AAGCTACCTTTTATTGATGTGAATGTCTTAGAATAAGCTTACCAAGAAGGTGAAAAGGCT
CTTGAAAAGTCAAAAAATGAATATGATAAGAACAGAAATATAAGATCATAAGATTTCATT
TTTGAATATGACTTGAATTCTTCTATTAACATTCCTGTTTTTAACAAACTTGTTCACCAC
TAGATCATAGAAAAAGCTAATGTGCACATAATTCCATTTAATCATTTAGATGCAACTTTA
CCTGATAAAATTACAAATTTAACTGTAGACATGGAAAAGAAAAATGCAGAAAGACAGCAG
TTTGAATAGAAAAAGAAGTTTAAGAAGTAGGATAGAGATGACTCAGAAGAATAAAATCAA
TACGAAAAAAAAGGAAAACACCATTACAAAAATGATAATCAAGATGAAAACCAAGAATAC
TCTAAGCATGGACATGGCCATGATAGTCACAAAGGACATTAACAACATGGAGGTCATGAA
GGTCATCATAAAAATTTCCATGGTACTCATCATTAGGGACATAATAAGCAAGAAGAAGAT
GATTGA


>TTHERM_00663830(protein)
MGVPGYFSWIHRKYPYQVRKVRRNGRKKHIDCLYIDVNGICYQYARDEHQYNYLLKPKSL
ETIFKQVIDHIDSIIELVEPQLQVYLMLDGPCPRAKMNQQRQRRFHAEMHHLTLKDELKK
HGFDVKEETVPNNSIAPGTPFMYELNEQLRRYIETRIALSNKAMTDGEADHKEHQVSYKK
LQFILSDSNAPGEGEHKILEVIRKHTNLQLTHCIVGADADLLLLSLATIGKRILILRENS
KFKGDKTDLEKELQKLKEELSHPQLDLHKEREYDLVDINGLKRVILDKYKKMFDNKQVQN
LKYNPMSLMDDFVFLSLFAGNDFLPRQNYMQIKSEKGHKPNILDKLIEKYDSYLETATSY
LSDRGFIKYNQIIEFFKQVATIEPKFKNNRIFEAPQKEEKSVFDYVKIMSQKQINNVEDI
KDQDLIDYDFKEEDLKLQQTSSVNEETEIPKDIIPISDSDEDQEEQKQSHDKEYHKKNKK
EQKKHHNQHDKDNQLASGTEDEQKKQKQNQEDDEEDEIQKILSDEMNGKEIYLKEKLKVT
NQQEYDLIIMKYLEGFEFTLLYYFRGIEKASWNYFYPHYYAPLTQDVVEFLERNPKFEVK
FVKTQPFQPYKQLLAILHPDNEALLPAEFKGLFKKYLQPFCPQILDIDKYGATMEHMQII
KLPFIDVNVLEQAYQEGEKALEKSKNEYDKNRNIRSQDFIFEYDLNSSINIPVFNKLVHH
QIIEKANVHIIPFNHLDATLPDKITNLTVDMEKKNAERQQFEQKKKFKKQDRDDSEEQNQ
YEKKGKHHYKNDNQDENQEYSKHGHGHDSHKGHQQHGGHEGHHKNFHGTHHQGHNKQEED
D


>TTHERM_00663830(gene)
ATGGGTGTACCAGGCTATTTTAGTTGGATTCACAGAAAGTATCCTTATCAAGTCAGAAAA
GTTAGACGCAACGGAAGAAAGAAACACATCGACTGCCTTTACATAGATGTAAACGGTATT
TGCTACTAATACGCTAGAGATGAGCACCAATATAACTATTTACTCAAACCTAAATCTCTT
GAAACTATATTTAAGCAAGTCATTGATCACATCGACTCAATTATCGAACTAGTAGAGCCT
TAGCTCTAAGTTTATCTTATGTTAGGTAAAATTTTCTAACACTTATATTATTTTAAACGC
TATTAATTTAACATTTTTTTTGTATTTTCTTTACTGATCCAATTGAAACGGTAATTCTTA
TACCTGAGGTTTTCAAATATGAAATCAGAAGAATACTTGGGTCTTCATGTTATTCAAAAC
AATTTTTTTTAATATTTAGCTTAGCAAATCCATTCTAACCAAATTTGAGTGGTTTTGAAA
GCTATTTTTGCATGATGAGATTCAAAAAAAATTAATTTTAATTAAAACTTTTCGCCATCT
TTTATATTTAAAAAATTATTCTTAAAAAAGATGGTCCATGCCCAAGAGCAAAGATGAACT
AGCAAAGACAAAGAAGATTCCATGCTGAAATGCATCATTTAACATTGAAGGATGAGCTCA
AAAAGCATGGATTTGATGTGAAGGAAGAAACCGTACCAAATAATTCAATTGCTCCAGGAA
CTCCTTTTATGTATGAACTAAATGAGTAGTTAAGGAGATATATTGAAACTCGTATTGCTT
TATCTAACAAAGCTATGACTGATGGAGAAGCAGATCATAAAGAGCATTAGGTAAGTTACA
AGAAGCTCTAATTTATCTTGAGTGATAGTAATGCTCCTGGCGAAGGTGAACATAAAATCC
TTGAAGTAATCAGAAAACATACTAATTTGTAGCTCACACATTGTATTGTTGGAGCTGATG
CAGATTTACTCCTCCTTTCTCTTGCAACAATTGGCAAGCGTATTTTGATTTTAAGAGAAA
ACTCAAAATTTAAAGGAGATAAGGTATTTATTTATTTAATAGACTCTTTAATTATTAATT
TTATTAATTAAAAAAATTAATTAAAACAGACAGATCTCGAAAAAGAATTATAGAAGCTTA
AGGAAGAACTTAGTCATCCACAATTAGACTTGCACAAAGAAAGAGAGTACGATTTAGTTG
ACATTAATGGATTGAAGAGAGTAATTCTTGATAAGTATAAGAAAATGTTTGACAATAAAC
AAGTATAGAATCTAAAATATAATCCTATGTCTCTTATGGATGATTTTGTCTTTTTAAGTT
TATTCGCTGGTAATGACTTCCTTCCTCGTTAGAATTACATGCAAATTAAATCAGAAAAAG
GACATAAACCTAACATTTTAGACAAGCTTATCGAAAAATATGATAGCTATCTTGAGACTG
CTACAAGTTATCTTAGTGATAGAGGTTTTATTAAATACAATTAAATCATAGAATTTTTTA
AGCAAGTAGCCACTATTGAGCCTAAATTCAAGAATAATAGAATTTTCGAAGCTCCTTAAA
AAGAAGAGAAATCGGTCTTTGATTACGTCAAAATTATGAGTTAGAAGTAAATCAATAACG
TTGAAGATATTAAGGATTAGGATTTGATTGATTACGATTTCAAAGAAGAAGACCTTAAAT
TATAATAGACCAGCTCTGTAAATGAAGAAACAGAAATCCCTAAGGATATTATTCCTATTT
CTGATAGCGATGAAGATTAGGAGGAATAAAAATAAAGCCATGATAAAGAATATCACAAAA
AAAATAAAAAGGAATAGAAAAAGCATCACAATCAACATGATAAGGATAATTAATTAGCAA
GTGGAACTGAAGATGAATAGAAAAAGTAAAAGTAGAATCAAGAAGATGATGAAGAAGATG
AAATTCAGAAAATATTGAGTGATGAAATGAATGGTAAAGAAATTTATTTGAAAGAAAAAC
TAAAAGTGACGAATTAGTAAGAATATGATTTAATTATCATGAAATATCTTGAAGGTTTTG
AATTCACCCTTCTTTACTATTTCCGTGGTATTGAGAAAGCTTCATGGAATTACTTTTACC
CTCACTATTATGCTCCTTTAACTCAAGATGTTGTTGAATTCTTAGAAAGAAATCCTAAAT
TTGAAGTTAAATTTGTCAAAACTCAGCCATTCTAACCTTACAAGCAACTTTTAGCTATTC
TTCATCCAGACAATGAAGCCCTCTTACCTGCCGAATTCAAAGGTTTATTTAAAAAATATC
TACAACCTTTTTGCCCTTAAATTTTAGATATTGATAAGTATGGAGCTACTATGGAGCATA
TGTAAATTATAAAGCTACCTTTTATTGATGTGAATGTCTTAGAATAAGCTTACCAAGAAG
GTGAAAAGGCTCTTGAAAAGTCAAAAAATGAATATGATAAGAACAGAAATATAAGATCAT
AAGATTTCATTTTTGAATATGACTTGAATTCTTCTATTAACATTCCTGTTTTTAACAAAC
TTGTTCACCACTAGATCATAGAAAAAGCTAATGTGCACATAATTCCATTTAATCATTTAG
ATGCAACTTTACCTGATAAAATTACAAATTTAACTGTAGACATGGAAAAGAAAAATGCAG
AAAGACAGCAGTTTGAATAGAAAAAGAAGTTTAAGAAGTAGGATAGAGATGACTCAGAAG
AATAAAATCAATACGAAAAAAAAGGAAAACACCATTACAAAAATGATAATCAAGATGAAA
ACCAAGAATACTCTAAGCATGGACATGGCCATGATAGTCACAAAGGACATTAACAACATG
GAGGTCATGAAGGTCATCATAAAAATTTCCATGGTACTCATCATTAGGGACATAATAAGC
AAGAAGAAGATGATTGA