Identifiers and Description

Gene Model Identifier

TTHERM_00145270

Standard Name

XRN2 (5'-3' exoribonuclease 2)

Aliases

PreTt26735 | 11.m00432 | 3702.m00154

Description

XRN 5'-3' exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF00098 ) Zinc knuckle
  • ( PF03159 ) XRN 5'-3' exonuclease N-terminus

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 18.3%

TetraMine Data

TTHERM_00145270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04743.19.997093137033517e-262XRN 5-3 exonuclease (1069 aa)
WormBaseWBGene000069644.998332321421836e-154locus:xrn-2 5-3 exoribonucle
ase 2 homolog status:Partial
ly_confirmed UniProt:Q9U299
protein_id:CAB54449.2
DictyBaseDDB_G02761379.99530525570754e-113xrn1 on chromosome: 2 position
6232603 to 6238286
SGDYOR048C7.00248144504223e-103RAT1 Nuclear 5 to 3 single-str
anded RNA exonuclease, involve
d in RNA metabolism, including
rRNA and snRNA processing as
well as poly (A+) dependent an
d independent mRNA transcripti
on termination
OxytrichaContig944.1.g45.0002513615276457e-88XRN 5-3 exonuclease N-terminus
Stentor CoeruleusSteCoe_175187.175095973164411e-66

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23084833: Couvillion MT, Bounova G, Purdom E, Speed TP, Collins K (2012) A Tetrahymena Piwi bound to mature tRNA 3' fragments activates the exonuclease Xrn2 for RNA processing in the nucleus. Molecular cell 48(4):509-20

Sequences

>TTHERM_00145270(coding)
ATGGGTGTTCCAGCATTCTTTAGGTGGCTATGTGCAAGAAATCCTTAATTTATTCTTGAT
GCTCATGAAAATTATGAGGAGTTTGACGCGGAGTCAAATAATCCAGAAATAGATAATTTA
TATTTAGATATGAATGGTATTATTCATCCATGTTGTCGTTCTGATGGTTCTGTTGTACCT
ATAGCTCATACAATTTAAGATATGTTTAATAACATATTTTTATACGTAGATAAGCTTATG
GATCTTTGTAGACCTAAGAAAATTTTGTACATGGCAATTGATGGTGTAGCTCCAAGAGCA
AAAATGAATCAGTAGAGAGCTAGAAGATTCAAAGGAGCTAAAGAAGCTGTAGAATTATAA
TAAAAAAAAGAAGAACTTCTTAATGAATTTCGTGAAAGAAGTGAAATTAATGATGATGTT
TTAGCTTTTGTTTAAAATAGATTTGATACAAATGTCATTACTCCAGGTACCGCTTTTATG
AGAGATTTGAGCATGGCCTTATAGCATTATGTTATTGAAAGAATGAACAAACATCCTTTA
TTTAAAGATATTAAAGTAATATTTTCAGATGCTAGTATTCCTGGTGAAGGAGAGCATAAA
ATATTGGATTTCATTAGAGTTTAAAGAGACTAGCAAAATTATGATCCTAATACTAAACAC
TGCTTGTATGGTGCTGATGCTGATTTAATTATGCTTGGATTAAGTACTCATGAGCCCTAT
TTTTATATTATTAGAGAATAAATTATTACTCAAGAAGAAAAACGTTGCTCCATATGTTAG
TAGACTGGACACTTTTAAATGGACTGTCCAAACGAGATGGCAGTTGAAGCTGGATAAAAA
CCAATTAGTTAAAAAATTCTTTAAGCTTAGGAGCAAAAGGTTAGAAAGGGAATCACCTAG
AGTTTTTAGTTTGCAAAATTATATGTAATGCGTCAATACTTAAACATGAGATTCTCAAAA
GTACTTTTCAACGATAATCTTGAGTGCAAATTGAAGATGCAATATGATATTGAAAGGATT
ATAGATGATTTTGTATTTATGTGCTTTTTTGTTGGTAATGACTTCTTACCTCACATACCT
AATTTGAGTATCCGTGATGGAGGTATAGATGCCTTACTTACTCTGTATGATCATACTATA
ACTCAAGTAGATGATTATTTAACTTGTAATGGGGAATTAAATCTTAAATAAGTAGCTAAA
TTATTAGAAAATATGGCAATTGTTGAAGAAGACTTAATGAAATTTAGAAAAGATAAAGAA
GATCGTGATAAAAAGAATTAAGAGATTAACAAAGAAAAGGAAGCAAGGCTCTAAGAATTA
AGGCCTCACATTTCTGAAGAGGAATACTAAAAGAAAAGAAAAGAGTGGAGATTAAAGGAT
GAGAAAAAAGTTGAGATAATTAACAATGAATCGTTATTGTAAAGATTTAAAAGAATATTA
TCAGAAAGAAGTAATGAGGCTAAGACTATTAAGGAAGTAAAAGAAAGCACTTAAATTACT
CTTAACTATAACTATAAATTATCTTATTATAATGATAAATTTGGTGTAAAACCTGAAGAT
TTTATCTAAATGCAGTGGCTTATTAAATAATCATATGTTGAAGCCTTATGTTGGAACTTT
GCTTATTATTATAAAGGATGCATAAGTTGGAGTTGGTATTATCCTTTCCATTATAGTCCT
TTTGCTTCAGATTTAATAGATATTGATTAGCATATCATAGAATTTGAGAGAGGCGAACCA
TTCAAGCCTTTCTATTAGTTACTCTCTGTCTTTCCTCCTGCAAGTGCTTTAAGTGTACCC
GAATGCTTTAGACCTCTTATGATTGAGCCAACTTCAGAAATAGCTGATTTCTATCCTATT
GATTTTTATGTTGATTTAATTGGAAAAAAATTTGAGTGGCTTGGTGAAGTCATTTTACCA
TTTATTGAAGAAGAAAGACTATTAAGGGCTGCTAGAAAATATGAGCATCTGCTATCTCCT
GAAGAAAAGCAAAGAAATACTCCTGGAAAAATTTAGATTTTTTATAATTAAACTTCTATA
AATTATCCTTTAGAACTTAACTAGACAGAACATAAAATTACAGGTGTTCTTGATAATAAT
TGCAACTTTTTGATTAATGGACCAATTAACTTGTTAGATCCTTAGCTAAATTTAAAAAGA
GTAACATTAAATAACGTTTAATGTAGAAACATTACTTTTCCTGAATTTGAGAAACATGGT
ATACAACTTTTAGAAGGACTTATTGAACCAGTCGAAGAGATTTCTGAAAGCTACATTGAC
AAAGCTGATATGAGAACTTATTAAGGAGAAAACGTAATCAAGCTAATTTAAAGAATCTTA
AGAGGATAAGATAATAGATAACCATGGTAAAGAATTAATGATGAAAGGAATAACTATGAG
TAAGGTAGAAGTTAATATGGAAATTCATTAAATTATAGAGAAATGATGAAATATTAAGAT
TAGATGAATTCCCTTTCTTCAGGGTTTAACTAAAACAATAACGATCATCAGTAAACAAAC
GATCAGTATCAATAATAAGATGGCTAGTCAAATAACATCTTCTCCTCTTTAGAAGAAAGA
TAGCCTAGATATTAAAGGTATAACAACGGTAGAAATTCATATAATAACAATAACAATTAC
AGAAATAATTAATACAATAATGGAAACAATAAAAACTTTTAAGGAGGAAAATATTAGAGA
AATAATTCTAATCAACAATATAATAATTAAAATGATGGAAATTATAATAGAAACTACAGC
AACAATAACTATAGCAATAACTATAACAATAATAATTATAATAATAATAATAATAATAGA
AATGATGGATATTAAAGGGGAGGATCGAATCAAAATAACAGGCGTTATAATAATGGAAAC
TAATATTAAGGTAGTGGAATCGATTTGAATAATGTTAACTAAATAAGATCTCAATATTAA
AATTAATAATTATACTAATAAACCTTTTAAAATTAACCTTAATAGCCAGTATAATAATCA
AACTTATAAATATTCGAGCCTGCATAAACAACATAACCTAAAATATAAGCACCATCTTAT
ATCAATCAGTTCTAATTCAAATAGAACCAACCACCTGCTCAGCCAAATAAGATTTACGAA
CCAGACATAGGTTTAAATGATGGTAATTAAGAATATGATCCTTTAGAAGCAATAAAGAAA
TAATTTAAGAAAAATTGA


>TTHERM_00145270(protein)
MGVPAFFRWLCARNPQFILDAHENYEEFDAESNNPEIDNLYLDMNGIIHPCCRSDGSVVP
IAHTIQDMFNNIFLYVDKLMDLCRPKKILYMAIDGVAPRAKMNQQRARRFKGAKEAVELQ
QKKEELLNEFRERSEINDDVLAFVQNRFDTNVITPGTAFMRDLSMALQHYVIERMNKHPL
FKDIKVIFSDASIPGEGEHKILDFIRVQRDQQNYDPNTKHCLYGADADLIMLGLSTHEPY
FYIIREQIITQEEKRCSICQQTGHFQMDCPNEMAVEAGQKPISQKILQAQEQKVRKGITQ
SFQFAKLYVMRQYLNMRFSKVLFNDNLECKLKMQYDIERIIDDFVFMCFFVGNDFLPHIP
NLSIRDGGIDALLTLYDHTITQVDDYLTCNGELNLKQVAKLLENMAIVEEDLMKFRKDKE
DRDKKNQEINKEKEARLQELRPHISEEEYQKKRKEWRLKDEKKVEIINNESLLQRFKRIL
SERSNEAKTIKEVKESTQITLNYNYKLSYYNDKFGVKPEDFIQMQWLIKQSYVEALCWNF
AYYYKGCISWSWYYPFHYSPFASDLIDIDQHIIEFERGEPFKPFYQLLSVFPPASALSVP
ECFRPLMIEPTSEIADFYPIDFYVDLIGKKFEWLGEVILPFIEEERLLRAARKYEHLLSP
EEKQRNTPGKIQIFYNQTSINYPLELNQTEHKITGVLDNNCNFLINGPINLLDPQLNLKR
VTLNNVQCRNITFPEFEKHGIQLLEGLIEPVEEISESYIDKADMRTYQGENVIKLIQRIL
RGQDNRQPWQRINDERNNYEQGRSQYGNSLNYREMMKYQDQMNSLSSGFNQNNNDHQQTN
DQYQQQDGQSNNIFSSLEERQPRYQRYNNGRNSYNNNNNYRNNQYNNGNNKNFQGGKYQR
NNSNQQYNNQNDGNYNRNYSNNNYSNNYNNNNYNNNNNNRNDGYQRGGSNQNNRRYNNGN
QYQGSGIDLNNVNQIRSQYQNQQLYQQTFQNQPQQPVQQSNLQIFEPAQTTQPKIQAPSY
INQFQFKQNQPPAQPNKIYEPDIGLNDGNQEYDPLEAIKKQFKKN


>TTHERM_00145270(gene)
ATGGGTGTTCCAGCATTCTTTAGGTGGCTATGTGCAAGAAATCCTTAATTTATTCTTGAT
GCTCATGAAAATTATGAGGAGTTTGACGCGGAGTCAAATAATCCAGAAATAGATAATTTA
TATTTAGATATGAATGGTATTATTCATCCATGTTGTCGTTCTGATGGTTCTGTTGTACCT
ATAGCTCATACAATTTAAGATATGTTTAATAACATATTTTTATACGTAGATAAGGTAAAT
TATAAATTAAATGTTTAAAGCTTTATAAATTTAGAATTAGTTGTTAGTCTTCTTTGCAGA
AAACATTGTTAAAGAAGACTAATTACTAAATTAGACTATTTTATTTAGGCATTATGTTTA
ATTAGCTTTTGAATTTATAAATTCTAATTTATTTTATATAGCTTATGGATCTTTGTAGAC
CTAAGAAAATTTTGTACATGGCAATTGATGGTGTAGCTCCAAGAGCAAAAATGAATCAGT
AGAGAGCTAGAAGATTCAAAGGAGCTAAAGAAGCTGTAGAATTATAATAAAAAAAAGAAG
AACTTCTTAATGAATTTCGTGAAAGAAGTGAAATTAATGATGATGTTTTAGCTTTTGTTT
AAAATAGATTTGATACAAATGTCATTACTCCAGGTAAAATTTATAAAAGGCATCTTTTTG
AATAATATTATCAATAGTTTTTTAAAAATTGGTTATTTTAACATACACTTTAACATTAAT
TTTAAGATTTATTTTTTTTTTAATTCATTAGGTACCGCTTTTATGAGAGATTTGAGCATG
GCCTTATAGCATTATGTTATTGAAAGAATGAACAAACATCCTTTATTTAAAGATATTAAA
GTAATATTTTCAGATGCTAGTATTCCTGGTGAAGGAGAGCATAAAATATTGGATTTCATT
AGAGTTTAAAGAGACTAGCAAAATTATGATCCTAATACTAAACACTGCTTGTATGGTGCT
GATGCTGATTTAATTATGCTTGGATTAAGTACTCATGAGCCCTATTTTTATATTATTAGA
GAATAAATTATTACTCAAGAAGAAAAACGTTGCTCCATATGTTAGTAGACTGGACACTTT
TAAATGGACTGTCCAAACGAGATGGCAGTTGAAGCTGGATAAAAACCAATTAGTTAAAAA
ATTCTTTAAGCTTAGGAGCAAAAGGTTAGAAAGGGAATCACCTAGAGTTTTTAGTTTGCA
AAATTATATGTAATGCGTCAATACTTAAACATGAGATTCTCAAAAGTACTTTTCAACGAT
AATCTTGAGTGCAAATTGAAGATGCAATATGATATTGAAAGGATTATAGATGATTTTGTA
TTTATGTGCTTTTTTGTTGGTAATGACTTCTTACCTCACATACCTAATTTGAGTATCCGT
GATGGAGGTATAGATGCCTTACTTACTCTGTATGATCATACTATAACTCAAGTAGATGAT
TATTTAACTTGTAATGGGGAATTAAATCTTAAATAAGTAGCTAAATTATTAGAAAATATG
GCAATTGTTGAAGAAGACTTAATGAAATTTAGAAAAGATAAAGAAGATCGTGATAAAAAG
AATTAAGAGATTAACAAAGAAAAGGAAGCAAGGCTCTAAGAATTAAGGCCTCACATTTCT
GAAGAGGAATACTAAAAGAAAAGAAAAGGTAAAAATTCATACTTTAAAAATAAATCACTA
CTTATTTTTTAATATGCAATAATAAATTTTAATCAGACAAACACTCTAAAATACTAAAAT
TAATTGATAATTAAAGATAAAAAATCTTAAGAATATTTTACTTTAAATGATAAAACAAAT
AAAATTTTTAAATTTACCATATCATTGCCAACAAAAAATATAATTTTATTATTTCCATTA
AAAAATGAATCATAAATTTTCTACTTCTGCAAATTTGTAGTAAATTTGATCATAGAATTA
GTTGAATTATATTTGTCAGTTTTTTACATTTTAATGTGATTGAAATAATTATTTATTTAT
TTATGTATTTAGATAAATTACAAATTATTATTATTTTAATTAAAAGAGTGGAGATTAAAG
GATGAGAAAAAAGTTGAGATAATTAACAATGAATCGTTATTGTAAAGATTTAAAAGAATA
TTATCAGAAAGAAGTAATGAGGCTAAGACTATTAAGGAAGTAAAAGAAAGCACTTAAATT
ACTCTTAACTATAACTATAAATTATCTTATTATAATGATAAATTTGGTGTAAAACCTGAA
GATTTTATCTAAATGCAGTGGCTTATTAAATAATCATATGTTGAAGCCTTATGTTGGAAC
TTTGCTTATTATTATAAAGGATGCATAAGTTGGAGTTGGTATTATCCTTTCCATTATAGT
CCTTTTGCTTCAGATTTAATAGATATTGATTAGCATATCATAGAATTTGAGAGAGGCGAA
CCATTCAAGCCTTTCTATTAGTTACTCTCTGTCTTTCCTCCTGCAAGTGCTTTAAGTGTA
CCCGAATGCTTTAGACCTCTTATGATTGAGCCAACTTCAGAAATAGCTGATTTCTATCCT
ATTGATTTTTATGTTGATTTAATTGGAAAAAAATTTGAGTGGCTTGGTGAAGTAAATTTA
TTTGAATTAATTTATTAAACTATTCAAAATCATATTAAATTGAATTAAATAATTATTATT
TCATCATCAGATGAAAAAAATTTTACTTTAATAAATACTAAAAATAATAAATTTAAATAA
ATTACAAGACAGTTTACATTAAATTTTGAAAAATAAAATGTAAAACAATTTAAATATTTT
TGATATGATAAGAGACTAAATAAATACTTCAAAATTTTTACAATAATTTCAGAAAATATA
AATATTAATAACTTAAAATTAATAATTAGGTCATTTTACCATTTATTGAAGAAGAAAGAC
TATTAAGGGCTGCTAGAAAATATGAGCATCTGCTATCTCCTGAAGAAAAGCAAAGAAATA
CTCCTGGAAAAATTTAGATTTTTTATAATTAAACTTCTATAAATTATCCTTTAGAACTTA
ACTAGACAGAACATAAAATTACAGGTGTTCTTGATAATAATTGCAACTTTTTGATTAATG
GACCAATTAACTTGTTAGATCCTTAGCTAAATTTAAAAAGAGTAACATTAAATAACGTTT
AATGTAGAAACATTACTTTTCCTGAATTTGAGAAACATGGTATACAACTTTTAGAAGGAC
TTATTGAACCAGTCGTAATATAATTTTACTTTTTTTACAAAATGCAAATAGCTTTCATGA
TTTTTAATTTTACAGTATTATTTTTTAAATAAAAATTTATTGAATAGGAAGAGATTTCTG
AAAGCTACATTGACAAAGCTGATATGAGAACTTATTAAGGAGAAAACGTAATCAAGCTAA
TTTAAAGAATCTTAAGAGGATAAGATAATAGATAACCATGGTAAAGAATTAATGATGAAA
GGAATAACTATGAGTAAGGTAGAAGTTAATATGGAAATTCATTAAATTATAGAGAAATGA
TGAAATATTAAGATTAGATGAATTCCCTTTCTTCAGGGTTTAACTAAAACAATAACGATC
ATCAGTAAACAAACGATCAGTATCAATAATAAGATGGCTAGTCAAATAACATCTTCTCCT
CTTTAGAAGAAAGATAGCCTAGATATTAAAGGTATAACAACGGTAGAAATTCATATAATA
ACAATAACAATTACAGAAATAATTAATACAATAATGGAAACAATAAAAACTTTTAAGGAG
GAAAATATTAGAGAAATAATTCTAATCAACAATATAATAATTAAAATGATGGAAATTATA
ATAGAAACTACAGCAACAATAACTATAGCAATAACTATAACAATAATAATTATAATAATA
ATAATAATAATAGAAATGATGGATATTAAAGGGGAGGATCGAATCAAAATAACAGGCGTT
ATAATAATGGAAACTAATATTAAGGTAGTGGAATCGATTTGAATAATGTTAACTAAATAA
GATCTCAATATTAAAATTAATAATTATACTAATAAACCTTTTAAAATTAACCTTAATAGC
CAGTATAATAATCAAACTTATAAATATTCGAGCCTGCATAAACAACATAACCTAAAATAT
AAGCACCATCTTATATCAATCAGTTCTAATTCAAATAGAACCAACCACCTGCTCAGCCAA
ATAAGATTTACGAACCAGACATAGGTTTAAATGATGGTAATTAAGAATATGATCCTTTAG
AAGCAATAAAGAAATAATTTAAGAAAAATTGA