Identifiers and Description

Gene Model Identifier

TTHERM_00645780

Standard Name

XRN1 (5'-3' exoribonuclease 1)

Aliases

PreTt15783 | 93.m00079 | 3727.m00001

Description

XRN 5'-3' exonuclease N-terminus family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.2%

TetraMine Data

TTHERM_00645780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18801.19.997093137033517e-262XRN 5-3 exonuclease (1743 aa)
WormBaseWBGene000127302.0009157491910723e-107locus:xrn-1 status:Partially
_confirmed UniProt:Q9BHK7
protein_id:CAC35856.3
DictyBaseDDB_G02761372.999467474389571e-105xrn1 on chromosome: 2 position
6232603 to 6238286
OxytrichaContig18254.0.g132.0008734984431652e-95XRN 5-3 exonuclease N-terminus
SGDYGL173C2.0000012618802033e-84XRN1 Evolutionarily-conserved
5-3 exonuclease component of c
ytoplasmic processing (P) bodi
es involved in mRNA decay; pla
ys a role in microtubule-media
ted processes, filamentous gro
wth, ribosomal RNA maturation,
and telomere maintenance
Stentor CoeruleusSteCoe_175187.984904245686979e-30

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00645780(coding)
ATGGGAGTTCCTGGATTTTATAGTTGGTTAGCTCGTAGATACCCTTTGATTCTTCACTAA
ATCAAGAAAGGTGAAGTTCCTAACATAGATTGTTTTTACCTCGATATGAATGGTATCATT
TATAAATGCTCTAAGGATGAAGGCACTGTTTTCAAAGACTTGCTTTTATAGAGAAACATT
TAGGAAATTTTCTCAATGATATTTAATTATATTGATGAAATGGTCAACTTAGTAGAACCA
AAGAAAGTTTTGTATCTCTTTCTTGATGGCCCATGTCCTCGTGCTAAGTAAAACCAATAG
CGTACTCGTCGTTTTTAGAGCGCTCAATCATGGAAAGACTTGAATGATTCTCTAAGAAAC
TGTGGTTTCCTATCCGAAGGAGAGACGATGAAGAATAACTCTATCTCAACAGGTACAGAA
TTCATGCATGATTTGAATAAGTAGCTCCATTTTTATATCTGCAAGAAATTCGAATAAGAT
CCTCGTTGGTCCAATCTTGAAGTTTTCTTTAGTGGATCCAACGTACCTGGTGAAGGTGAA
CATAAAATTATTAATTTTATGCATTAGTATTGTTCATCCTAAGATTATGATCCAACTACT
ACTCATTGTATTTATGGTGCAGATGCAGATCTTATCATGTTAGGCTTATCTACCCATATT
AAATATGTCTCAATTCTGAGAGAAGAAATGAAATTTTAACCTCCTGTAAGTAGAGCTGCT
AAAAGAGATAGAGAATCAGTAACATTTTAGATGATCTACTTAAATATAGTTAGAGAATAT
ATGGAGTTAGAATATAAGATGTTATGGAAAAAAGTAAAAAAGCTTGAGTTTAACATTGAA
AGAGTTATTGATGATTTCCTTTTAATCTGTTGTTTCATTGGTAATGATTTCCTACCAAGA
CTGTATTGTTTCAATATTAGAGAAGGACAATTTGAAATTTTGATTTAGATTTATAAAGAT
TATCTAGTTGAAGCAGATTCATATTTAAATGATAATGGTCATATTAATTGGGTTGGTCTT
CAATAGATAATTTAAAGAATAGCAGAAGTTGAGCTTGATTTTATTGGAGATAAAGCTACA
GATATCACAAAGGAATATAAAAGACGTATCAAGCATCAATCAGATAAAGATCAAGAAATC
GGAGATGATGAAGTTCCCGGAGTTAAAAAAGGAAATGATAAGAAAAACTCCTCTTCAGAA
GGTGAAAATGATGAAGATGACGAAGATTTCGAAGATGAAGACGATGATGATTATGATGAT
GATATCTGCGATGATAATGATGAAAAGGATTAAGAAAAAAATGATTAAAAAAATCAAGTC
ACTTTCTAACAAAATTTTGAAAAAAACCTTCAAGAAAAGAAGAAAGAAGAAGACAAAATT
ATCAAAAAAGAAAAAGATTTTATTAATGATTTATAAGAAAATTATAAAAAAGATTAGTTT
TTAGGAAAATCATATTATTATTAGCAAAAGCTTAACTTAGATTTCAAGAATTTTGATGAT
ATTAAGACATTAGATTTATTGATAACTAAGTATTTAGAAGGTTTATAGTTTGTTTTGCTT
TATTACTACCAAGGATGTCCTTCCTGGAGCTGGTATTTCCCATTCTATTATGCTCCTATG
ACTTCAGATATCAGTTTATTCTTGAATTACAAGGCTGAACATTTATCATAAGAAATTGTA
TTTGATCTTTCCGAACCATACCCTCCTATGAAATAGTTAATGTGTATTATACATCCTGAA
AATGCAAATTTGCTCCCTAAGCCTTTTGCTCAATTATTGACTGATCCTAATTCAAAATTA
AGAAGCCCTGTAGATTACTATCCTGATAAATTTACAATTGATCCCTATGGAGGTGTATTC
TCACATGAATATATTGTAGTCCTTCCCTTTATGGACTAAAAATTAATAGATGATGTTTAT
TCTTCTATTGATTAAGTAAAAACTTTAACTCCTTAGGAAAGAGAGCGCAATTAATTTGGA
AAGAATATTAAGTACAAATTTGACCATAACTTTGCTCCTATTACTATTTAGAGCACACTT
CCTAATTACTATAAGGACTTTTAAGTAACTTTGAAAGTAGAAACATTTGATATCGGTAAA
GTATACTCTCCACCCACAAATCCTTAAGGTGAAGCTTTATCTAGATTCCCTACTCTCCAT
GCTAAATAGGTTATTGGATGTGAGATTGATAAAGTAGAAAAAGGTTTACAAATGAAAATC
AGAGTTAAAAGTGATTTGACTGAGGCAGATATTGTTAATAAAGTTAGAGGAAAACCTAAA
TATGATGCTTATTGCAAATACCCTAATTGCGAAAAAGTATAAGTCACTGGTTTTCTAACT
GAAAGTACTTTCAAAAATATATGGAAGAATAAGAATCTTTCCATCCTTGAAAATTTAGAC
TACAGTGAAGATTCTCATCACAGTTTCTATTTAAAAATAAAAGACGAACTGTCCTAAACA
TTTTACAAGAAGGGAGGAATTATATACAACCATTCTAATCCCGTGATTGCCATTTTGTTA
AAGTATACTGAAGGTAGAAGAACTTTAAAGGGTACTATTATAGAAAACAGTGATAAATAT
GAGGAGATGTTTTGTCCTCTTGATTTATTAATGAAGGAATAGAAAATCGAAAAAGTCATT
CAAGTTACTAAATGTGATAATATAGAAAAAGAGTTCCCTATTGGTTGTAAAGTTGTAATA
GCTTAAAAAGGAAATCTTGATGGTCATACAGGTATTGTGACAGGATACACCAAAGGAAAG
CTTGCACAAGAACTTTTAGTTTAATTAAAGACTAAGCCTGTCTATTTGACTGACAATCAA
CTAAAATTCTACTCAAAGGATGATGAAGCATTCATAACCTTGAAATTTTTGTCATTCAAG
CTTTAATTATCATAAGATGTTTTACTTGATATCTTAGATAGCTTTAGCATTAAAATTGAA
CCTAATCTTCCTTCTGCTAATAAACTTCCAAAGATGCTTGATGTAGGTTTAAATATCATC
AGAAGACATCTTAATGAAGTTGTTCCTGAACTTGCTCGTATTAATGAAGCATCTTAAAAT
ATTTCAGGACGTGAAAAGTATCAATAATTTAGAGAATTGGAATTGAGTCCTTCATTAGTT
AAGTTAATTATTGAATACTATAATGCTTACCCAAAAATATTTGCTTTTGTTGCTAAACTT
TCATAATTAAGAAAGAAGGATAAAAACGCTAATTTTTACTCTGGCTAAATTTGGTCTAAA
GAAGGCCAAGATCCTAACATTGAATTAGTTAAGCTATATATTTGGTTAATGAAAAAGAAG
GAATCTCAATTCTGTAGCTCAACCGTTGCCTCAAAGGTTATGCACTCATAAAAAATTGAA
TAGTTGGTCAAATTTTAAGATGAATTTGTTTAAACTAAGCTCAACATTCCTTAAAAAGAT
TAGACCATTCATTAAATAGATGCCAACAATGCTATTCCTGCCGTCTATAGCTCAAAACAA
TATATTTACTTTAAAGATTAACCTTTTTACCATGAGGTAGGTGACTAAGTAATTTACATA
GGTACTTATAACACTAAGAATGCTCCTTTTGGACTATAGGGAACTATAGTTGGTATCATG
GATGACAAATTTGAAGTTGTCTTTATAAAACCTTTCATCGGAGGTGTTAATTTAGGAGGT
CGTTGTCCTCCTCAACGTGGTCTCGTAGTTTAATTCGATGAAATTTATAACTTACAAGGT
TGGAATAATTTCTTGCAAAACAGAGACAATTCTAAAGAAAATACTTTAGGCTGGAATGGA
TGGGTTGATGAGTACAAACCTCAATTCCGTGAAGCTATCAAGAGCGATAAAGATCTCTAA
AATAAATAAGCTAATAATGAAACTTAAAAGTTAATAGGTGAGATCATGCATTAACCAGAA
GCTAATTTGAAATCTGAGACTAGTGATAAGCCCAAAACTAATGTCATAGCAGTTATCAAA
AAGCAAACAAATGGTTCAAAAGGAACTGATACCATTTCAGAGGTAACTCAAGAACAAGCT
TCAGCTTAGATAGCTTAATAACAATAATAAGGCAAAGTCACTATTGGACCTGCTCCAACA
ACTGTTCCTCAAAAAACTGAACAGAAACAATAGACATAATCTACTTCTCCTAGCAAAACA
GAGACCTAGAAGAAACCTTAGAAGGAAACTGTCATTTATGTTAAGAAATCAGAAGTTAGT
TAATAATAATAAGTAGAATAAAAATAACCAAGCACCTAAATTACCCAATAAGAAGAGAAA
AAAGAATCTGAAAGCGTTAAATAAGAAAAAGTGGAAGAATCTCAACAACAATAAATCGTT
TAAGAGGCTGCATTATAAGCTCAAGAAGTATAAATAGTTAAATCTGATTAAATAGAAGTG
CCAAAAGAAGATAATAGTAATCAAAATGAAAACATTTAAGATGTCTCTGAAATAGAAAAG
TTATTGCAAGAATAGAAACAATTCTAGGAAGAAGAACAAAAGCACTAAATTTTGGATGTT
TCTGAGATTGAAAAACAATAAACTGATGTCTAAGAATTCGAAATTCCAAAGGAGTGCAAC
TTAGAAGAAATCGAAAAATAAATGCTTCAAGATCAATTTGAGCATATTAAACATCAAGAT
TAAAAAGATCCCGAAATGTTGGATGTTGCGAAATTCGAAAAAGAATAAATGGAACTAGCT
TAAAAAGAAGCCAAGGGATAAAATCAAGAATCCAACAAATTTTAAGATGATGATAAAGAT
GATACATAAAAACTAAGCAGAAAGCAGAAGAAATTAAAAAATAAAGATATTACTGGTTTT
AATCCTGGATAAAGTGCCGTATAGTTTAAAAATAGAGAATAAGTTAACTAAGAAAAGAGA
ATGAAAAGAAACGAAAAGAGGTTAATGATTCAAGAACAAAATCTTTAATATTAATAATAT
TAGCAATATTATCAATATCTTTATTTGTGGTAGTAGTAATTTATTAAATAGAAAACTTAA
GAAATGGAAGCATTTAAGAGAAGATAAGAAGAAGAAAGGATCAACAAGAGTCTTGCTCAG
CTTACAAATCCCGTTACAGAAGGTGAATCAGTCAACTAAGATCTAATTAACATACAGAAT
GCTCTAGAACAATAGAATTCAAAGAACTCAAATTTACCTCAAGATATTTAAATGGTTGAC
TCTTCTCAAATAGAGCAAAAGCTTTCAGAAAATATTATTCCTTAGGTTCCTTTAACTACA
ATCTAACAAGGCAATGTAAGAAATGAAATTGTAGGAAATTTAACTGCTGAAGACTTGGAA
AACTTCGAAGAATTAGAAAGACAATATCTCAGTTCATTAAATAAATGA


>TTHERM_00645780(protein)
MGVPGFYSWLARRYPLILHQIKKGEVPNIDCFYLDMNGIIYKCSKDEGTVFKDLLLQRNI
QEIFSMIFNYIDEMVNLVEPKKVLYLFLDGPCPRAKQNQQRTRRFQSAQSWKDLNDSLRN
CGFLSEGETMKNNSISTGTEFMHDLNKQLHFYICKKFEQDPRWSNLEVFFSGSNVPGEGE
HKIINFMHQYCSSQDYDPTTTHCIYGADADLIMLGLSTHIKYVSILREEMKFQPPVSRAA
KRDRESVTFQMIYLNIVREYMELEYKMLWKKVKKLEFNIERVIDDFLLICCFIGNDFLPR
LYCFNIREGQFEILIQIYKDYLVEADSYLNDNGHINWVGLQQIIQRIAEVELDFIGDKAT
DITKEYKRRIKHQSDKDQEIGDDEVPGVKKGNDKKNSSSEGENDEDDEDFEDEDDDDYDD
DICDDNDEKDQEKNDQKNQVTFQQNFEKNLQEKKKEEDKIIKKEKDFINDLQENYKKDQF
LGKSYYYQQKLNLDFKNFDDIKTLDLLITKYLEGLQFVLLYYYQGCPSWSWYFPFYYAPM
TSDISLFLNYKAEHLSQEIVFDLSEPYPPMKQLMCIIHPENANLLPKPFAQLLTDPNSKL
RSPVDYYPDKFTIDPYGGVFSHEYIVVLPFMDQKLIDDVYSSIDQVKTLTPQERERNQFG
KNIKYKFDHNFAPITIQSTLPNYYKDFQVTLKVETFDIGKVYSPPTNPQGEALSRFPTLH
AKQVIGCEIDKVEKGLQMKIRVKSDLTEADIVNKVRGKPKYDAYCKYPNCEKVQVTGFLT
ESTFKNIWKNKNLSILENLDYSEDSHHSFYLKIKDELSQTFYKKGGIIYNHSNPVIAILL
KYTEGRRTLKGTIIENSDKYEEMFCPLDLLMKEQKIEKVIQVTKCDNIEKEFPIGCKVVI
AQKGNLDGHTGIVTGYTKGKLAQELLVQLKTKPVYLTDNQLKFYSKDDEAFITLKFLSFK
LQLSQDVLLDILDSFSIKIEPNLPSANKLPKMLDVGLNIIRRHLNEVVPELARINEASQN
ISGREKYQQFRELELSPSLVKLIIEYYNAYPKIFAFVAKLSQLRKKDKNANFYSGQIWSK
EGQDPNIELVKLYIWLMKKKESQFCSSTVASKVMHSQKIEQLVKFQDEFVQTKLNIPQKD
QTIHQIDANNAIPAVYSSKQYIYFKDQPFYHEVGDQVIYIGTYNTKNAPFGLQGTIVGIM
DDKFEVVFIKPFIGGVNLGGRCPPQRGLVVQFDEIYNLQGWNNFLQNRDNSKENTLGWNG
WVDEYKPQFREAIKSDKDLQNKQANNETQKLIGEIMHQPEANLKSETSDKPKTNVIAVIK
KQTNGSKGTDTISEVTQEQASAQIAQQQQQGKVTIGPAPTTVPQKTEQKQQTQSTSPSKT
ETQKKPQKETVIYVKKSEVSQQQQVEQKQPSTQITQQEEKKESESVKQEKVEESQQQQIV
QEAALQAQEVQIVKSDQIEVPKEDNSNQNENIQDVSEIEKLLQEQKQFQEEEQKHQILDV
SEIEKQQTDVQEFEIPKECNLEEIEKQMLQDQFEHIKHQDQKDPEMLDVAKFEKEQMELA
QKEAKGQNQESNKFQDDDKDDTQKLSRKQKKLKNKDITGFNPGQSAVQFKNREQVNQEKR
MKRNEKRLMIQEQNLQYQQYQQYYQYLYLWQQQFIKQKTQEMEAFKRRQEEERINKSLAQ
LTNPVTEGESVNQDLINIQNALEQQNSKNSNLPQDIQMVDSSQIEQKLSENIIPQVPLTT
IQQGNVRNEIVGNLTAEDLENFEELERQYLSSLNK


>TTHERM_00645780(gene)
ATGGGAGTTCCTGGATTTTATAGTTGGTTAGCTCGTAGATACCCTTTGATTCTTCACTAA
ATCAAGAAAGGTGAAGTTCCTAACATAGATTGTTTTTACCTCGATATGAATGGTATCATT
TATAAATGCTCTAAGGATGAAGGCACTGTTTTCAAAGACTTGCTTTTATAGAGAAACATT
TAGGAAATTTTCTCAATGATATTTAATTATATTGATGAAATGGTCAACTTAGTAGAACCA
AAGAAAGTTTTGTATCTCTTTCTTGATGGCCCATGTCCTCGTGCTAAGTAAAACCAATAG
CGTACTCGTCGTTTTTAGAGCGCTCAATCATGGAAAGACTTGAATGATTCTCTAAGAAAC
TGTGGTTTCCTATCCGAAGGAGAGACGATGAAGAATAACTCTATCTCAACAGGTACAGAA
TTCATGCATGATTTGAATAAGTAGCTCCATTTTTATATCTGCAAGAAATTCGAATAAGAT
CCTCGTTGGTCCAATCTTGAAGTTTTCTTTAGTGGATCCAACGTACCTGGTGAAGGTGAA
CATAAAATTATTAATTTTATGCATTAGTATTGTTCATCCTAAGATTATGATCCAACTACT
ACTCATTGTATTTATGGTGCAGATGCAGATCTTATCATGTTAGGCTTATCTACCCATATT
AAATATGTCTCAATTCTGAGAGAAGAAATGAAATTTTAACCTCCTGTAAGTATTTCTTAT
AATATTATTTATTTCAACTAGAATAAATTTAATAAACAAAAATTCATTTCATGCGCTCCA
ATAATAAGTATGGTCGCTTTCAAGATAACGAAATTAAAATGATATTATCTTCATTTTGAA
TCATTTTCTATTTATTATTTTGTTCAACCGATAATTAATTAAAGACTTTTTAAAAAAATA
AAAGAATAAATAAATAAATAGGAAATAAAAATTTAAAATAAAATTTCTTATCAAAAATAC
AATAATTACTTATTAAAGATTATTAAAATGAATTAATTAAATTATAAAGGTAAGTAGAGC
TGCTAAAAGAGATAGAGAATCAGTAACATTTTAGATGATCTACTTAAATATAGTTAGAGA
ATATATGGAGTTAGAATATAAGATGTTATGGAAAAAAGTAAAAAAGCTTGAGTTTAACAT
TGAAAGAGTTATTGATGATTTCCTTTTAATCTGTTGTTTCATTGGTAATGATTTCCTACC
AAGACTGTATTGTTTCAATATTAGAGAAGGACAATTTGAAATTTTGATTTAGATTTATAA
AGATTATCTAGTTGAAGCAGATTCATATTTAAATGATAATGGTCATATTAATTGGGTTGG
TCTTCAATAGATAATTTAAAGAATAGCAGAAGTTGAGCTTGATTTTATTGGAGATAAAGC
TACAGATATCACAAAGGAATATAAAAGACGTATCAAGCATCAATCAGATAAAGATCAAGA
AATCGGAGATGATGAAGTTCCCGGAGTTAAAAAAGGAAATGATAAGAAAAACTCCTCTTC
AGAAGGTGAAAATGATGAAGATGACGAAGATTTCGAAGATGAAGACGATGATGATTATGA
TGGTAAATAATAAAATTATAATCTTAGTTATTAAATATTTAAATTTTAATCAAAAGATGA
TATCTGCGATGATAATGATGAAAAGGATTAAGAAAAAAATGATTAAAAAAATCAAGTCAC
TTTCTAACAAAATTTTGAAAAAAACCTTCAAGAAAAGAAGAAAGAAGAAGACAAAATTAT
CAAAAAAGAAAAAGATTTTATTAATGATTTATAAGAAAATTATAAAAAAGATTAGTTTTT
AGGAAAATCATATTATTATTAGCAAAAGCTTAACTTAGATTTCAAGAATTTTGATGATAT
TAAGACATTAGATTTATTGATAACTAAGTATTTAGAAGGTTTATAGTTTGTTTTGCTTTA
TTACTACCAAGGATGTCCTTCCTGGAGCTGGTATTTCCCATTCTATTATGCTCCTATGAC
TTCAGATATCAGTTTATTCTTGAATTACAAGGCTGAACATTTATCATAAGAAATTGTATT
TGATCTTTCCGAACCATACCCTCCTATGAAATAGTTAATGTGTATTATACATCCTGAAAA
TGCAAGTAATTATATTAAATTATTTATTTATTTAACAAACCGGCAAATAAATAACTATTT
ATTTTTTAATATTGGGGATAAATATTAATTTTGTTTGAATATTTCTTTCATATTTTGAAT
TCATTTAATATTATTAATAAAATCTAATAATAAGAATAAATTAAAATATCCCCCCACTAA
TGATTTATGATTGAATAAATAATTTAGCTTTCCTAATTTAATATTTTTTTATTTTAAATA
AATTAGATTTGCTCCCTAAGCCTTTTGCTCAATTATTGACTGATCCTAATTCAAAATTAA
GAAGCCCTGTAGATTACTATCCTGATAAATTTACAATTGATCCCTATGGAGGTGTATTCT
CACATGAATATATTGTAGTCCTTCCCTTTATGGACTAAAAATTAATAGATGATGTTTATT
CTTCTATTGATTAAGTAAAAACTTTAACTCCTTAGGAAAGAGAGCGCAATTAATTTGGAA
AGAATATTAAGTACAAATTTGACCATAACTTTGCTCCTATTACTATTTAGAGCACACTTC
CTAATTACTATAAGGACTTTTAAGTAACTTTGAAAGTAGAAACATTTGATATCGGTAAAG
TATACTCTCCACCCACAAATCCTTAAGGTGAAGCTTTATCTAGATTCCCTACTCTCCATG
CTAAATAGGTTATTGGATGTGAGATTGATAAAGTAGAAAAAGGTTTACAAATGAAAATCA
GAGTTAAAAGTGATTTGACTGAGGCAGATATTGTTAATAAAGTTAGAGGAAAACCTAAAT
ATGATGCTTATTGCAAATACCCTAATTGCGAAAAAGTATAAGTCACTGGTTTTCTAACTG
AAAGTACTTTCAAAAATATATGGAAGAATAAGAATCTTTCCATCCTTGAAAATTTAGACT
ACAGTGAAGATTCTCATCACAGTTTCTATTTAAAAATAAAAGACGAACTGTCCTAAACAT
TTTACAAGAAGGGAGGAATTATATACAACCATTCTAATCCCGTGATTGCCATTTTGTTAA
AGTATACTGAAGGTAGAAGAACTTTAAAGGGTACTATTATAGAAAACAGTGATAAATATG
AGGAGATGTTTTGTCCTCTTGATTTATTAATGAAGGAATAGAAAATCGAAAAAGTCATTC
AAGTTACTAAATGTGATAATATAGAAAAAGAGTTCCCTATTGGTTGTAAAGTTGTAATAG
CTTAAAAAGGAAATCTTGATGGTCATACAGGTATTGTGACAGGATACACCAAAGGAAAGC
TTGCACAAGAACTTTTAGTTTAATTAAAGACTAAGGTAATAAATAGTTTATCCTTTTTTT
ATTTAAATCATTTTATTTATTTCTAAATCTAAACTAAATTATTCTTAACAATAAATAGCC
TGTCTATTTGACTGACAATCAACTAAAATTCTACTCAAAGGATGATGAAGCATTCATAAC
CTTGAAATTTTTGTCATTCAAGCTTTAATTATCATAAGATGTTTTACTTGATATCTTAGA
TAGCTTTAGCATTAAAATTGAACCTAATCTTCCTTCTGCTAATAAACTTCCAAAGATGCT
TGATGTAGGTTTAAATATCATCAGAAGACATCTTAATGAAGTTGTTCCTGAACTTGCTCG
TATTAATGAAGCATCTTAAAATATTTCAGGACGTGAAAAGTATCAATAATTTAGAGAATT
GGAATTGAGTCCTTCATTAGTTAAGTTAATTATTGAATACTATAATGCTTACCCAAAAAT
ATTTGCTTTTGTTGCTAAACTTTCATAATTAAGAAAGAAGGATAAAAACGCTAATTTTTA
CTCTGGCTAAATTTGGTCTAAAGAAGGCCAAGATCCTAACATTGAATTAGTTAAGCTATA
TATTTGGTTAATGAAAAAGAAGGAATCTCAATTCTGTAGCTCAACCGTTGCCTCAAAGGT
TATGCACTCATAAAAAATTGAATAGTTGGTCAAATTTTAAGATGAATTTGTTTAAACTAA
GCTCAACATTCCTTAAAAAGATTAGACCATTCATTAAATAGATGCCAACAATGCTATTCC
TGCCGTCTATAGCTCAAAACAATATATTTACTTTAAAGATTAACCTTTTTACCATGAGGT
AGGTGACTAAGTAATTTACATAGGTACTTATAACACTAAGAATGCTCCTTTTGGACTATA
GGGAACTATAGTTGGTATCATGGATGACAAATTTGAAGTTGTCTTTATAAAACCTTTCAT
CGGAGGTGTTAATTTAGGAGGTCGTTGTCCTCCTCAACGTGGTCTCGTAGTTTAATTCGA
TGAAATTTATAACTTACAAGGTTGGAATAATTTCTTGCAAAACAGAGACAATTCTAAAGA
AAATACTTTAGGCTGGAATGGATGGGTTGATGAGTACAAACCTCAATTCCGTGAAGCTAT
CAAGAGCGATAAAGATCTCTAAAATAAATAAGCTAATAATGAAACTTAAAAGTTAATAGG
TGAGATCATGCATTAACCAGAAGCTAATTTGAAATCTGAGACTAGTGATAAGCCCAAAAC
TAATGTCATAGCAGTTATCAAAAAGCAAACAAATGGTTCAAAAGGAACTGATACCATTTC
AGAGGTAACTCAAGAACAAGCTTCAGCTTAGATAGCTTAATAACAATAATAAGGCAAAGT
CACTATTGGACCTGCTCCAACAACTGTTCCTCAAAAAACTGAACAGAAACAATAGACATA
ATCTACTTCTCCTAGCAAAACAGAGACCTAGAAGAAACCTTAGAAGGAAACTGTCATTTA
TGTTAAGAAATCAGAAGTTAGTTAATAATAATAAGTAGAATAAAAATAACCAAGCACCTA
AATTACCCAATAAGAAGAGAAAAAAGAATCTGAAAGCGTTAAATAAGAAAAAGTGGAAGA
ATCTCAACAACAATAAATCGTTTAAGAGGCTGCATTATAAGCTCAAGAAGTATAAATAGT
TAAATCTGATTAAATAGAAGTGCCAAAAGAAGATAATAGTAATCAAAATGAAAACATTTA
AGATGTCTCTGAAATAGAAAAGTTATTGCAAGAATAGAAACAATTCTAGGAAGAAGAACA
AAAGCACTAAATTTTGGATGTTTCTGAGATTGAAAAACAATAAACTGATGTCTAAGAATT
CGAAATTCCAAAGGAGTGCAACTTAGAAGAAATCGAAAAATAAATGCTTCAAGATCAATT
TGAGCATATTAAACATCAAGATTAAAAAGATCCCGAAATGTTGGATGTTGCGAAATTCGA
AAAAGAATAAATGGAACTAGCTTAAAAAGAAGCCAAGGGATAAAATCAAGAATCCAACAA
ATTTTAAGATGATGATAAAGATGATACATAAAAACTAAGCAGAAAGCAGAAGAAATTAAA
AAATAAAGATATTACTGGTTTTAATCCTGGATAAAGTGCCGTATAGTTTAAAAATAGAGA
ATAAGTTAACTAAGAAAAGAGAATGAAAAGAAACGAAAAGAGGTTAATGATTCAAGAACA
AAATCTTTAATATTAATAATATTAGCAATATTATCAATATCTTTATTTGTGGTAGTAGTA
ATTTATTAAATAGAAAACTTAAGAAATGGAAGCATTTAAGAGAAGATAAGAAGAAGAAAG
GATCAACAAGAGTCTTGCTCAGCTTACAAATCCCGTTACAGAAGGTGAATCAGTCAACTA
AGATCTAATTAACATACAGAATGCTCTAGAACAATAGAATTCAAAGAACTCAAATTTACC
TCAAGATATTTAAATGGTTGACTCTTCTCAAATAGAGCAAAAGCTTTCAGAAAATATTAT
TCCTTAGGTTCCTTTAACTACAATCTAACAAGGCAATGTAAGAAATGAAATTGTAGGAAA
TTTAACTGCTGAAGACTTGGAAAACTTCGAAGAATTAGAAAGACAATATCTCAGTTCATT
AAATAAATGA