Identifiers and Description

Gene Model Identifier

TTHERM_000160559

Standard Name

XPF1 (homolog of Xeroderma Pigmentosum group F-complementing protein 1)

Aliases

None

Description

14-3-3 protein 6

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_000160559

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05314.19.997093137033517e-262hypothetical protein (1229 aa)
SGDYPL022W5.002276765025871e-34RAD1 Single-stranded DNA endon
uclease (with Rad10p), cleaves
single-stranded DNA during nu
cleotide excision repair and d
ouble-strand break repair; sub
unit of Nucleotide Excision Re
pair Factor 1 (NEF1); homolog
of human XPF protein
DictyBaseDDB_G02844199.99967697349061e-30xpf on chromosome: 4 position
1971161 to 1974139
OxytrichaContig829.1.g1351.9996410647472548e-29hypothetical protein
WormBaseWBGene000081404.998394530072393e-19locus:xpf-1 status:Partially
_confirmed UniProt:G5EBZ1
protein_id:CAA93766.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000160559(coding)
ATGAGCGAATCTATTAATTAGGATAATATTTAAAATAACAATCAGATTATCAAAAATGAA
GTAGATGATGAAGATTTAATGTAATAAAATATTTTAAACTAGCCTGAAGAGAGCAAGTTA
GATTATTTCGATTTGATACAAAAGGACCTTATTTATAGTCCTACTGGAGGGTTGTTAATT
ATGTCTTAAGGTACTGGTGTCTATAAAGTGATTGGGGAATATTTAGATACGTTTTAATAA
GGACCACAAACAGTCTTTTTTTTGCTTAATTTTGATGAAAGGGATAGCCTAAAATCTGAA
ATCAATGAAATTTAATATTACTGCAAACAGCACAAAATTGTTGATGTAACAAATATGATT
TCATCTAAAAGAAGTGAAATTTATAGCAAAGGAGGAATATTTTCAATATCAGAAATAGTT
CTCCTATTTGATTTGCTAAGTGGCAGCATCATCCACTCAGAAAGAATTACTGGGTTTATT
ATTAATAAAATATAAAGTGTTAGAAACCACTAAGAGAATCTAGTCTGGTTGTGTACTCTT
CTAAAGACAAACAATCCTTCTTCTATAATTTTAGGGATTTCTGAGTGTGAGTAGACATTA
GCAAGTAGAGGGTTAGAAAATATAATGAGATGGTTCTATTTACCTAGATGCTTTGTATGG
AACATGATTAGAGCAGAAGTTCAAAGTGATATTCTAAAATAGCCAAATCAATGCGAGCAC
TTGGATACGTTTGTGGATATGAATAAAAGAATGAGAAATATTGATAATTGTATTAAAGTT
ATCATAATTTTAATACTGAAAGAACTCAAATCTAAGAGAAATGCAAGTGACACAACAGAA
TTACCTATATTCAATTAGGAAGAATTCTTAAACTCTCATTAATACATTTTGGAGGATAAA
ATCAAATCCAATAAATTCTACTTAAAAGCCTTTATGAATAACACACAGTACTTTAAAGAT
GCTTTTGAATTTAAGCAGTTACAAAAAGATCTCTTTTAGCTAAATTGTGTTTCCTTCTAT
AAAAAATTACTCTATATTGATTAAAATTCAAATGAAGACAGCTTCATAAATAGGACAGCA
ACCGATAAAAGTACTCAAAAAGTAATTAAAGAGCTTTTTGAAAATGCATAAAAAAGAGTT
TATGAAATTCAAAAAAGCGATGAAACATTGGAGCTGCCATTGTTGGAGTCTCAATTAAAT
AATTCTGATAGAGATAGTTTTTAATTTAGATAAAAATTTAATTTAAATGGTTACTTTGAT
GCCAGCCTTCTCTAAAACACAGGTAAAAATGTAGAGTAATTGTAAAATGATGCTGATAAA
GACTTAGCAGAGTAAAATGATTTGAAAAGAGCCTCTTTAAATTCAATTGAAATGGCAGAT
GAAAATTTAAAGGGGAAAACTAGTTCATAAGAAAATTCATAAAATGGTTTAAACTCCTAA
GGCTTTCTTGATAGGTCTGCTGATTAAATAAATCTAACATAGTCTATTTAAATGACTTCA
ATTAAAGAAAATATCAAAGAAGATGAAACATTTGAAGAAAGTAAAAATGAAAATTAATTA
CTAAAATAAGATATGCTTGATGTGGAGGACAAACATTTAAATGAAAACTCTCAAGATAAG
TTTATGTAACAGATGGAATTTATGAGAAACATTATTAATCAAGATTCAATTTCATTAGCT
TAAGACATGCCTAAAGTAGGTTTGAAATAGAATATATTTGAAGATTTCGACACTGACAAT
AAAGATGCAATTAAATTTGAACTCAATCAAAAAGTAAAGTTAAATTTGGATATAGATCCT
AAATTTAGGTGCCTGAATGTTATTTTAAATGAAATAAACGAAAAATATTAAAATGCCATG
CCAATTAATGGAGACAAATTTTTGATTTGGATTCATACTAATGATAAACAGAGAGTGTCA
TCGATTTAAGAGTACATTTAAAACACTTTTCTCAAAAATGATCCTTCAAACAAACTAAGC
TTGATGAAAAAGTTTAGATAGTTTTTAGAAGAATAGACACATAGGAGACACTCTTATCTC
AAAGAATTAATCAAAAGAAAAAAAAATTAAATCCTTGAAGAAAAGAAAGAGTGTGAAAAT
GTGTTGCTTGAATAGCTATTTAAAGAGTTGGAATACTTTTAGTAAATAATTGAATTTGAG
CAATTGGAATTGAATAAAAATCAAAATAATTAACTTAATCCAGACGATAATATTTTATTT
GGTTCTTAAAGACAGCTAAACTAAGAAAATAAACAAAAACTAGATGAAATGGAAAAGGAA
GAATAAAAGAAAATAAAAGAAAACTCATAAGAGGACTCAAAAAAATAATCTTAGAATGAT
TAGAATCTAGAAATTGCAAGTGATGAAGAAAAAAATAATATAAAAAAAATAAGAAAAAGC
GATAGGATGCTTGCAGATAATGAAAAAGAATTGCTAGAAGTGAAAAAGAGAAAATTATAA
ATTGATGAAAAACTACAAAAAAGATTTAAAATGATAGATGTAAATTCAATGAATGTTAAT
ATTATTGATGAAATTGATCAGACAGGATTCGTTTAGTTTTTGTCTAAATAAATTATGAAA
AACTTCGAATTTATTGTAAACAGCACAAATAAATCAGTTATTAGATAACATTTCTTAAGA
ACTTATCGTCCAAATTTTGTCATATTATTTGAACCTAATTTGAGCATCATAAGAGAAATT
AGTGTAGGGCAGCATCTAATCTAATTAAACGGAGTAAATCCAATCTATGAAATTAGGACA
ATCATGTTCAATAAGTCTGCTGAAAGTGAGAAAATTCTTTATAATAGTCTTCAAGAGAAT
TAAGCAACTGAGAGAATAGTGAAAGAAAAAAATGAGATGCTAAGCAGTATTGATGAGCCA
GTATTAAGAGTAAAAAATATTACAAAAAAAGCAAATACTAGAATAGGTGGCTCTATGTTG
CAAGTTCAACCAGCAGTTATCATTGATAAAAGAGAGTTTAGAAGTGATTTACCTTCAATA
CTATTTCATGAAGGTTTTAAAGTTATACCTATTTAATTAACTACTGGAGATTATATATTA
TCAAAAGATATAGCTGTAGAAAGAAAATCAGTGGAAACTCCAGATTTAGTAAACAGTTTA
AGAAACGGTAGACTTTATTAGCAGCTATTGGCAATGTCTAAAAATTATAAGAAATGTTAC
TTACTTATAGAATTTTCAGAATAAATGCCTTTTAGCTTAGAGTCAATTAATTACAATAAT
GAAAACTAGCTTTCTTACTAAGAGCAGCAAAATTTCAATAACAAATAACCAAAAACAAAC
ACCATTACTTTTTATTTGCCTCTCCTCGTCTCTTAATTCGATAATGTTAAAATAATTTGG
TCGAAAGGTCCTATTTACACTTCTAAAATATTCTAAATGCTCAAATAAAATTAACTTGAG
CCAAATCCTTCAGAACTACTTAAAGAATAAGAGAAGAAAGAAAAGAAGGAATCTACAATA
GATTAGTATATCTAAGCAAATTAAGATGATGACAAATATATTCCAACCTAAAAACGATTA
TTTGAGCAAATTAAAAATAGCAACGAAGAAGAAAATTGA


>TTHERM_000160559(protein)
MSESINQDNIQNNNQIIKNEVDDEDLMQQNILNQPEESKLDYFDLIQKDLIYSPTGGLLI
MSQGTGVYKVIGEYLDTFQQGPQTVFFLLNFDERDSLKSEINEIQYYCKQHKIVDVTNMI
SSKRSEIYSKGGIFSISEIVLLFDLLSGSIIHSERITGFIINKIQSVRNHQENLVWLCTL
LKTNNPSSIILGISECEQTLASRGLENIMRWFYLPRCFVWNMIRAEVQSDILKQPNQCEH
LDTFVDMNKRMRNIDNCIKVIIILILKELKSKRNASDTTELPIFNQEEFLNSHQYILEDK
IKSNKFYLKAFMNNTQYFKDAFEFKQLQKDLFQLNCVSFYKKLLYIDQNSNEDSFINRTA
TDKSTQKVIKELFENAQKRVYEIQKSDETLELPLLESQLNNSDRDSFQFRQKFNLNGYFD
ASLLQNTGKNVEQLQNDADKDLAEQNDLKRASLNSIEMADENLKGKTSSQENSQNGLNSQ
GFLDRSADQINLTQSIQMTSIKENIKEDETFEESKNENQLLKQDMLDVEDKHLNENSQDK
FMQQMEFMRNIINQDSISLAQDMPKVGLKQNIFEDFDTDNKDAIKFELNQKVKLNLDIDP
KFRCLNVILNEINEKYQNAMPINGDKFLIWIHTNDKQRVSSIQEYIQNTFLKNDPSNKLS
LMKKFRQFLEEQTHRRHSYLKELIKRKKNQILEEKKECENVLLEQLFKELEYFQQIIEFE
QLELNKNQNNQLNPDDNILFGSQRQLNQENKQKLDEMEKEEQKKIKENSQEDSKKQSQND
QNLEIASDEEKNNIKKIRKSDRMLADNEKELLEVKKRKLQIDEKLQKRFKMIDVNSMNVN
IIDEIDQTGFVQFLSKQIMKNFEFIVNSTNKSVIRQHFLRTYRPNFVILFEPNLSIIREI
SVGQHLIQLNGVNPIYEIRTIMFNKSAESEKILYNSLQENQATERIVKEKNEMLSSIDEP
VLRVKNITKKANTRIGGSMLQVQPAVIIDKREFRSDLPSILFHEGFKVIPIQLTTGDYIL
SKDIAVERKSVETPDLVNSLRNGRLYQQLLAMSKNYKKCYLLIEFSEQMPFSLESINYNN
ENQLSYQEQQNFNNKQPKTNTITFYLPLLVSQFDNVKIIWSKGPIYTSKIFQMLKQNQLE
PNPSELLKEQEKKEKKESTIDQYIQANQDDDKYIPTQKRLFEQIKNSNEEEN


>TTHERM_000160559(gene)
ATGAGCGAATCTATTAATTAGGATAATATTTAAAATAACAATCAGATTATCAAAAATGAA
GTAGATGATGAAGATTTAATGTAATAAAATATTTTAAACTAGCCTGAAGAGAGCAAGTTA
GATTATTTCGATTTGATACAAAAGGACCTTATTTATAGTCCTACTGGAGGGTTGTTAATT
ATGTCTTAAGGTACTGGTGTCTATAAAGTGATTGGGGAATATTTAGATACGTTTTAATAA
GGACCACAAACAGTCTTTTTTTTGCTTAATTTTGATGAAAGGGATAGCCTAAAATCTGAA
ATCAATGAAATTTAATATTACTGCAAACAGCACAAAATTGTTGATGTAACAAATATGATT
TCATCTAAAAGAAGTGAAATTTATAGCAAAGGAGGAATATTTTCAATATCAGAAATAGTT
CTCCTATTTGATTTGCTAAGTGGCAGCATCATCCACTCAGAAAGAATTACTGGGTTTATT
ATTAATAAAATATAAAGTGTTAGAAACCACTAAGAGAATCTAGTCTGGTTGTGTACTCTT
CTAAAGACAAACAATCCTTCTTCTATAATTTTAGGGATTTCTGAGTGTGAGTAGACATTA
GGTATCAGCATTATTTATAAATGTTTCTAACTAATTTTTTTGAAAATATATATATTAAAT
AGCAAGTAGAGGGTTAGAAAATATAATGAGATGGTTCTATTTACCTAGATGCTTTGTATG
GAACATGATTAGAGCAGAAGTTCAAAGTGATGTATGAGATTATCAAAAATAAATCTAAAA
ATGATATTTTTTATTTTGTCGATAAAGATTCTAAAATAGCCAAATCAATGCGAGCACTTG
GATACGTTTGTGGATATGAATAAAAGAATGAGAAATATTGATAATTGTATTAAAGTTATC
ATAATTTTAATACTGAAAGAACTCAAATCTAAGAGAAATGCAAGTGACACAACAGAATTA
CCTATATTCAATTAGGAAGAATTCTTAAACTCTCATTAATACATTTTGGAGGATAAAATC
AAATCCAATAAATTCTACTTAAAAGCCTTTATGAATAACACACAGTACTTTAAAGATGCT
TTTGAATTTAAGCAGTTACAAAAAGATCTCTTTTAGCTAAATTGTGTTTCCTTCTATAAA
AAATTACTCTATATTGATTAAAATTCAAATGAAGACAGCTTCATAAATAGGACAGCAACC
GATAAAAGTACTCAAAAAGTAATTAAAGAGCTTTTTGAAAATGCATAAAAAAGAGTTTAT
GAAATTCAAAAAAGCGATGAAACATTGGAGCTGCCATTGTTGGAGTCTCAATTAAATAAT
TCTGATAGAGATAGTTTTTAATTTAGATAAAAATTTAATTTAAATGGTTACTTTGATGCC
AGCCTTCTCTAAAACACAGGTAAAAATGTAGAGTAATTGTAAAATGATGCTGATAAAGAC
TTAGCAGAGTAAAATGATTTGAAAAGAGCCTCTTTAAATTCAATTGAAATGGCAGATGAA
AATTTAAAGGGGAAAACTAGTTCATAAGAAAATTCATAAAATGGTTTAAACTCCTAAGGC
TTTCTTGATAGGTCTGCTGATTAAATAAATCTAACATAGTCTATTTAAATGACTTCAATT
AAAGAAAATATCAAAGAAGATGAAACATTTGAAGAAAGTAAAAATGAAAATTAATTACTA
AAATAAGATATGCTTGATGTGGAGGACAAACATTTAAATGAAAACTCTCAAGATAAGTTT
ATGTAACAGATGGAATTTATGAGAAACATTATTAATCAAGATTCAATTTCATTAGCTTAA
GACATGCCTAAAGTAGGTTTGAAATAGAATGTAAATATTAAATTTTATTTTTTTATTAAA
TAAATAAAGAAATATTTTTATATTTTAGATATTTGAAGATTTCGACACTGACAATAAAGA
TGCAATTAAATTTGAACTCAATCAAAAAGTAAAGTTAAATTTGGATATAGATCCTAAATT
TAGGTGCCTGAATGTTATTTTAAATGAAATAAACGAAAAATATTAAAATGCCATGCCAAT
TAATGGAGACAAATTTTTGATTTGGATTCATACTAATGATAAACAGAGAGTGTCATCGAT
TTAAGAGTACATTTAAAACACTTTTCTCAAAAATGATCCTTCAAACAAACTAAGCTTGAT
GAAAAAGTTTAGATAGTTTTTAGAAGAATAGACACATAGGAGACACTCTTATCTCAAAGA
ATTAATCAAAAGAAAAAAAAATTAAATCCTTGAAGAAAAGAAAGAGTGTGAAAATGTGTT
GCTTGAATAGCTATTTAAAGAGTTGGAATACTTTTAGTAAATAATTGAATTTGAGCAATT
GGAATTGAATAAAAATCAAAATAATTAACTTAATCCAGACGATAATATTTTATTTGGTAA
TTATTTATATTTTAATGCTGAGCATAATTCTAAAAACAAAAATAAAAGGTTCTTAAAGAC
AGCTAAACTAAGAAAATAAACAAAAACTAGATGAAATGGAAAAGGAAGAATAAAAGAAAA
TAAAAGAAAACTCATAAGAGGACTCAAAAAAATAATCTTAGAATGATTAGAATCTAGAAA
TTGCAAGTGATGAAGAAAAAAATAATATAAAAAAAATAAGAAAAAGCGATAGGATGCTTG
CAGATAATGAAAAAGAATTGCTAGAAGTGAAAAAGAGAAAATTATAAATTGATGAAAAAC
TACAAAAAAGATTTAAAATGATAGATGTAAATTCAATGAATGTTAATATTATTGATGAAA
TTGATCAGACAGGATTCGTTTAGTTTTTGTCTAAATAAATTATGAAAAACTTCGAATTTA
TTGTAAACAGCACAAATAAATCAGTTATTAGATAACATTTCTTAAGAACTTATCGTCCAA
ATTTTGTAAATATTTTACTTCTTAAACAAAAATAAAATTCCCTTTTACTTTGAAAAAGGT
CATATTATTTGAACCTAATTTGAGCATCATAAGAGAAATTAGTGTAGGGCAGCATCTAAT
CTAATTAAACGGAGTAAATCCAATCTATGAAATTAGGACAATCATGTTCAATAAGTCTGC
TGAAAGTGAGAAAATTCTTTATAATAGTCTTCAAGAGAATTAAGCAACTGAGAGAATAGT
GAAAGAAAAAAATGAGATGCTAAGCAGTATTGATGAGCCAGTATTAAGAGTAAAAAATAT
TACAAAAAAAGCAAATACTAGAATAGGTGGCTCTATGTTGCAAGTTCAACCAGCGTAATT
AATTTTTTATGATATATTTTATTTAACTGAAATATTAAAATATTAAATAATAAAAAAGAG
TTATCATTGATAAAAGAGAGTTTAGAAGTGATTTACCTTCAATACTATTTCATGAAGGTT
TTAAAGTTATACCTATTTAATTAACTACTGGAGATTATATATTATCAAAAGATATAGCTG
TAGAAAGAAAATCAGTGGAAACTCCAGATTTAGTAAACAGTTTAAGAAACGGTAGACTTT
ATTAGCAGCTATTGGCAATGTCTAAAAATTATAAGAAATGTTACTTACTTATAGAATTTT
CAGAATAAATGCCTTTTAGCTTAGAGTCAATTAATTACAATAATGAAAACTAGCTTTCTT
ACTAAGAGCAGCAAAATTTCAATAACAAATAACCAAAAACAAACACCATTACTTTTTATT
TGCCTCTCCTCGTCTCTTAATTCGATAATGTTAAAATAATTTGGTCGAAAGGTCCTATTT
ACACTTCTAAAATATTCTAAATGCTCAAATAAAATTAACTTGAGCCAAATCCTTCAGAAC
TACTTAAAGAATAAGAGAAGAAAGAAAAGAAGGAATCTACAATAGATTAGTATATCTAAG
CAAATTAAGATGATGACAAATATATTCCAACCTAAAAACGATTATTTGAGCAAATTAAAA
ATAGCAACGAAGAAGAAAATTGA