Identifiers and Description

Gene Model Identifier

TTHERM_00529620

Standard Name

XPB1 (homolog of Xeroderma Pigmentosum type B protein 1)

Aliases

PreTt04631 | 67.m00146 | 3684.m00016

Description

DNA repair helicase Rad25; DNA repair helicase rad25 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR00603 ) DNA repair helicase rad25
  • ( PF00176 ) SNF2 family N-terminal domain
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00529620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13686.19.997093137033517e-262DNA repair helicase rad25 fami
ly protein (831 aa)
DictyBaseDDB_G02787292.0005528695435914e-146repB on chromosome: 3 position
1389108 to 1391685
OxytrichaContig5586.0.g364.9990774786573115e-144Helicase conserved C-terminal
domain
WormBaseWBGene000134417.998494937295598e-144status:Partially_confirmed U
niProt:Q95PZ4 protein_id:CAC
70144.1
SGDYIL143C3.0004885828297914e-109SSL2 Component of the holoenzy
me form of RNA polymerase tran
scription factor TFIIH, has DN
A-dependent ATPase/helicase ac
tivity and is required, with R
ad3p, for unwinding promoter D
NA; involved in DNA repair; ho
molog of human ERCC3
Stentor CoeruleusSteCoe_90568.628801156620959e-60

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00529620(coding)
ATGGCTGATAAAAAGGTTAATCCAAAATCTAGAGAATAAAGTAAAAGATTAAAGTCAAAC
TCATAAAAATAAAATTAAAATGGCAAATAATAAAAGAATGAAGAAGGAGATGATGGCTTA
TTTGGCTAAAAATAAGGAAAAGCACAAGTAGAAGGAAATTAATTTCAATAATTTTATGAT
TACTCTACTCTAGAATTAAAAGATGATTACAGAGAAAGACCTATTTTGATATGTCCAGAT
GGAATAATATTTTTAGAAACTTTTAATCCTCTTTACAGGGTTGCCTATTAATTTTTAATT
TCTATTGGAGAGCCTGTGTAAAGACCTCTCTCAATGCATAAATTTACCTTGACTAAGTAT
TCACTTTATACTGCGATGGTTTTATAGTATGAACCTAAAGATATAATTCTGTGTCTCGAA
AAGCTTAGTAAGAACAAAAAAATTCCTAAAGAAGTAGAAAGATATATTACTGAAAATACA
TAAAACTATGGAGCTGCTAGACTATTTTTAGACGACAGTAGTTATTACTTAGATATAGAT
TCTTAGGTATGGACAAGTATAATAGAAAGAAATCCACATATAAAAGACCTAGTTTCACAA
ACATAATTTAACTTTGATAATATTATAAACTAAAATAAAGAATTGAGGGATATTTAAAAA
GATCTGCAAAGCTTCTTTTAAAATATAAAAACAGAAAACAATTAATAATCTTCAAAAAAA
AACTAGAAAATGATTGTTGAAGATGAGCAAGATGATGGAATTCCAGATAAAAAAAATAAA
TTAATGAAAAACGGTGATAGCAGTATTGCTAATTATGATGACGAAGATGAAGAAGATTCT
GATGATGGTGATGATGATTTTGTTTATAATTTCATAATGAATAATAAAACAAAACGGTCT
TTTAAACGTATTTAAATTATTGGAGATCATTTTGAGGTTACTAAAGCTGTTATTAACTGT
AGTGTTCCTCTGATTTAAGAATATGATTTCGAAAACAAAAGCTTCAAATAACTAGAAATT
GAATTAAAGCCAAAAATAAAGGTGAGATATTACCAAGAAAGAGCTTTAAAAAATATATTT
ATATAGAAGAAAGCTCGTTCTGGATTGATAATTCTTCCTTGTGGTGCAGGGAAAACAATT
GTTGGAGTTATTGCTATCGAAAGGATAAAATAAAGTACAGTAATTATTTGTGACTCTGAT
GTTTCTGTGGATTAATGGAGAGATGAACTTGAGAGATGGACTACAATTAATAAAAACAAA
ATAGTTAGATTAACTGGTAGAATAGTGGATGAATGGCCTACTAGAACTACAGATGAGCCT
ATTATTGTGATTACAACATATTATATGCTTGTAAAAAAGCGTGAAGATCTTCCTCCAACT
TAAATTGCTTAAAAGAGCAAAAAGAGATAATACATAGACTCAATGAAGGAAAGAAAATGG
GGAGTTTGTGTGATTGATGAAGTGCATAAATTGCCAGCAAATACTTTTTAAAATGTACTT
AAGCAGTATAAATTCCACTTTAAACTAGGTCTCACTGCTACTCCTTACAGAGAAGATGAA
AAGATTATTAATTTATTTTATATGATAGGACCTAAGTTGTATGAAGAAAATTGGTATGAT
TTAGTTAGTTAAGGATTTTTAGCTAAACCCTACTGTGTAGAAATTAGATGTGAAATGTCG
TAGCTCTGGATGAGCGAGTATAATAAGAAAGATTTAAAGACAGGTAAAAATTACTACAGA
GGGCCATAAAGAGAGTTAATACATACAAGTAACCCAAGAAAATTTAAGACTCTTGAGTAT
CTCATAAAAGTTCATGAAGAAAGAGGAGATAAAATTCTAGTTTTTTGTGATAGACCAATG
ATAATAGATTATTATGGAAATATTTTAAAATATCCAGTTATATATGGAGATGTATCACAA
GATGAGAGAAAGAAAATATTTAATCTATTTAAAGTTTCAAACTAGATAAATACAATATTT
CTTTCCAGAGTTGGAGATACAGCAATAGATTTGCCTCAGGCTAACGTTGGTATCTAAATT
GGAATGCATTTTAAAAGTAGGAGATAAGAAGTTTAGAGGTTAGGTAGAATCATGAGAGCT
AAAGAAAACTATGATGGTTAATATAATGCTTTTTGGTATACATTAGTTTCAAAAGGAACT
GATGAAACTTCCTACTGTTTAGCAAGGCAAAAATGTTTAATAAATTAAGGTTTCAAATAT
GAAATTATTGATGAAAAAGATTTACCATATAGTTAAAATCCTTAAAAGTTTAAGTGGATG
TCTTAATTAGATGAGTCAGATTATCTTTACACATTATTAATGAATTCTGAACAAAATCAG
CAAAATGGCAAAATGTCAAGTGAAGAAGAAAGCTCGAGTGGTGATAGCTCAGGATCAGAT
TCTGAAGAATCAGAAGGACATTTTAATATCACTACAAAAGCTGCAAACCCTTTATAAAAT
CTAGCACTTTACAAAGAAACATAGCTTAATAAATACTGA


>TTHERM_00529620(protein)
MADKKVNPKSREQSKRLKSNSQKQNQNGKQQKNEEGDDGLFGQKQGKAQVEGNQFQQFYD
YSTLELKDDYRERPILICPDGIIFLETFNPLYRVAYQFLISIGEPVQRPLSMHKFTLTKY
SLYTAMVLQYEPKDIILCLEKLSKNKKIPKEVERYITENTQNYGAARLFLDDSSYYLDID
SQVWTSIIERNPHIKDLVSQTQFNFDNIINQNKELRDIQKDLQSFFQNIKTENNQQSSKK
NQKMIVEDEQDDGIPDKKNKLMKNGDSSIANYDDEDEEDSDDGDDDFVYNFIMNNKTKRS
FKRIQIIGDHFEVTKAVINCSVPLIQEYDFENKSFKQLEIELKPKIKVRYYQERALKNIF
IQKKARSGLIILPCGAGKTIVGVIAIERIKQSTVIICDSDVSVDQWRDELERWTTINKNK
IVRLTGRIVDEWPTRTTDEPIIVITTYYMLVKKREDLPPTQIAQKSKKRQYIDSMKERKW
GVCVIDEVHKLPANTFQNVLKQYKFHFKLGLTATPYREDEKIINLFYMIGPKLYEENWYD
LVSQGFLAKPYCVEIRCEMSQLWMSEYNKKDLKTGKNYYRGPQRELIHTSNPRKFKTLEY
LIKVHEERGDKILVFCDRPMIIDYYGNILKYPVIYGDVSQDERKKIFNLFKVSNQINTIF
LSRVGDTAIDLPQANVGIQIGMHFKSRRQEVQRLGRIMRAKENYDGQYNAFWYTLVSKGT
DETSYCLARQKCLINQGFKYEIIDEKDLPYSQNPQKFKWMSQLDESDYLYTLLMNSEQNQ
QNGKMSSEEESSSGDSSGSDSEESEGHFNITTKAANPLQNLALYKETQLNKY


>TTHERM_00529620(gene)
ATGGCTGATAAAAAGGTTAATCCAAAATCTAGAGAATAAAGTAAAAGATTAAAGTCAAAC
TCATAAAAATAAAATTAAAATGGCAAATAATAAAAGAATGAAGAAGGAGATGATGGCTTA
TTTGGCTAAAAATAAGGAAAAGCACAAGTAGAAGGAAATTAATTTCAATAATTTTATGAT
TACTCTACTCTAGAATTAAAAGATGATTACAGAGAAAGACCTATTTTGATATGTCCAGAT
GGAATAATATTTTTAGAAACTTTTAATCCTCTTTACAGGGTTGCCTATTAATTTTTAATT
TCTATTGGAGAGCCTGTGTAAAGACCTCTCTCAATGCATAAATTTACCTTGACTAAGTAT
TCACTTTATACTGCGATGGTTTTATAGTATGAACCTAAAGATATAATTCTGTGTCTCGAA
AAGCTTAGTAAGAACAAAAAAATTCCTAAAGAAGTAGAAAGATATATTACTGAAAATACA
TAAAACTATGGAGCTGCTAGACTATTTTTAGACGACAGTAGTTATTACTTAGATATAGAT
TCTTAGGTATGGACAAGTATAATAGAAAGAAATCCACATATAAAAGACCTAGTTTCACAA
ACATAATTTAACTTTGATAATATTATAAACTAAAATAAAGAATTGAGGGATATTTAAAAA
GATCTGCAAAGCTTCTTTTAAAATATAAAAACAGAAAACAATTAATAATCTTCAAAAAAA
AACTAGAAAATGATTGTTGAAGATGAGCAAGATGATGGAATTCCAGATAAAAAAAATAAA
TTAATGAAAAACGGTGATAGCAGTATTGCTAATTATGATGACGAAGATGAAGAAGATTCT
GATGATGGTGATGATGATTTTGTTTATAATTTCATAATGAATAATAAAACAAAACGGTCT
TTTAAACGTATTTAAATTATTGGAGATCATTTTGAGGTTACTAAAGCTGTTATTAACTGT
AGTGTTCCTCTGATTTAAGAATATGATTTCGAAAACAAAAGCTTCAAATAACTAGAAATT
GAATTAAAGCCAAAAATAAAGGTGAGATATTACCAAGAAAGAGCTTTAAAAAATATATTT
ATATAGAAGAAAGCTCGTTCTGGATTGATAATTCTTCCTTGTGGTGCAGGGAAAACAATT
GTTGGAGTTATTGCTATCGAAAGGATAAAATAAAGTACAGTAATTATTTGTGACTCTGAT
GTTTCTGTGGATTAATGGAGAGATGAACTTGAGAGATGGACTACAATTAATAAAAACAAA
ATAGTTAGATTAACTGGTAGAATAGTGGATGAATGGCCTACTAGAACTACAGATGAGCCT
ATTATTGTGATTACAACATATTATATGCTTGTAAAAAAGCGTGAAGATCTTCCTCCAACT
TAAATTGCTTAAAAGAGCAAAAAGAGATAATACATAGACTCAATGAAGGAAAGAAAATGG
GGAGTTTGTGTGATTGATGAAGTGCATAAATTGCCAGCAAATACTTTTTAAAATGTACTT
AAGCAGTATAAATTCCACTTTAAACTAGGTCTCACTGCTACTCCTTACAGAGAAGATGAA
AAGATTATTAATTTATTTTATATGATAGGACCTAAGTTGTATGAAGAAAATTGGTATGAT
TTAGTTAGTTAAGGATTTTTAGCTAAACCCTACTGTGTAGAAATTAGATGTGAAATGTCG
TAGCTCTGGATGAGCGAGTATAATAAGAAAGATTTAAAGACAGGTAAAAATTACTACAGA
GGGCCATAAAGAGAGTTAATACATACAAGTAACCCAAGAAAATTTAAGACTCTTGAGTAT
CTCATAAAAGTTCATGAAGAAAGAGGAGATAAAATTCTAGTTTTTTGTGATAGACCAATG
ATAATAGATTATTATGGAAATATTTTAAAATATCCAGTTATATATGGAGATGTATCACAA
GATGAGAGAAAGAAAATATTTAATCTATTTAAAGTTTCAAACTAGATAAATACAATATTT
CTTTCCAGAGTTGGAGATACAGCAATAGATTTGCCTCAGGCTAACGTTGGTATCTAAATT
GGAATGCATTTTAAAAGTAGGAGATAAGAAGTTTAGAGGTTAGGTAGAATCATGAGAGCT
AAAGAAAACTATGATGGTTAATATAATGCTTTTTGGTATACATTAGTTTCAAAAGGAACT
GATGAAACTTCCTACTGTTTAGCAAGGCAAAAATGTTTAATAAATTAAGGTTTCAAATAT
GAAATTATTGATGAAAAAGATTTACCATATAGTTAAAATCCTTAAAAGTTTAAGTGGATG
TCTTAATTAGATGAGTCAGATTATCTTTACACATTATTAATGAATTCTGAACAAAATCAG
CAAAATGGCAAAATGTCAAGTGAAGAAGAAAGCTCGAGTGGTGATAGCTCAGGATCAGAT
TCTGAAGAATCAGAAGGACATTTTAATATCACTACAAAAGCTGCAAACCCTTTATAAAAT
CTAGCACTTTACAAAGAAACATAGCTTAATAAATACTGA