Identifiers and Description

Gene Model Identifier

TTHERM_00294660

Standard Name

XLF1 (XRCC4-like factor)

Aliases

PreTt15576 | 27.m00236 | 3692.m00039

Description

XLF family protein; assists in annealing broken ends of DNA in the non-homologous end joining (NHEJ) pathway

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( TIGR00537 ) methylase, putative
  • ( PF09302 ) XLF (XRCC4-like factor)
  • ( PF08241 ) methyltransferase domain
  • ( PF05175 ) methyltransferase small domain
  • ( TIGR00536 ) methyltransferase, HemK family
  • ( TIGR03387 ) protein-(glutamine-N5) methyltransferase, release factor-specific
  • ( TIGR03386 ) protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.1%

TetraMine Data

TTHERM_00294660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08721.12.0009778678102968e-172hypothetical protein (581 aa)
OxytrichaContig19116.0.1.g1010.00000000000059990805086298hypothetical protein
DictyBaseDDB_G02847850.000009999254677478949nhej1 on chromosome: 4 positio
n 2481017 to 2482785

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000145

Sequences

>TTHERM_00294660(coding)
ATGTACGCTTAAACACTCTCTGAAGCTTTAACTTTGAATGAAATTATTTTTTTAAAAAAG
TAAATTTGGTGGACTGGCTGTACTGAAACACCATTTATATGTCGTGGAGGAGTTTATAAT
AAAAATAGCTATCTTTTAGTGATCACAGATACACGTAATGTATGGGTAACAAAGGCAGAT
GATTAACAGATTATAGATGAGAAAGATAAATTTAACTAATCAATAAAGATAAAATTTGAA
GATATTTTGAATACTCTTGATACTCCACTCAGATTTGGTAGAAGCAATACTTAATTTACA
AAGCTATAATTCAGAAAAAATAGAGAAGAAGATCTAATTTTCTTAATGGAATTTTAAGTA
GGAATTTATCCTTTCAAATGGGAGTTCTTTTTAACAAAGATGGATGATAGCGAAATTTTT
AATATTTTAGCTGATGATTTATTAAATCCTATGGCTAAAACAATAATGTCTCTTGAAAAA
AGAGGAAACTTGTATAAATAAAAATGTATTCAAATAGAAAAAGAGTTGTTAAGACGCTTA
AGCGAAAAGGAGAGAAATACATATCTTTCCTCCATTGATAAAGATAATGAGGAAGTTTGG
TCAAATTTCTTAATAGTAGATTCTTAAGATGATAAACTGACAAATTTTGACTTTGGTCCA
GCCGCTTAATTCTTTCTGTCAAATCACAACTCCAAAAATTTAATTTAAGATTAAGAAAAT
AAAAAAATTACAGCCAATTAGTAAAATGATATAATGGACAACAACGAAGACTTAAAAAGA
ATGAAATTAATTTAAGATTATTTTAGCACCTTTGAAGAATAGCCTTTGCCAAATGCTTAT
TTAAGACCAGATTCTAAAAAGAAATTTAAATAATAAGAAGAAAACAACTAATTAAAATAC
AAATAATAATAGCTAGGAATCAAAGTCAATTATGAAGAATAAAATGAAAATAAAATTGCT
AATGAGTAAGTATAAATATAAATTTAACAGAATGTTCAAAAAGAAGAAAAGAAAAAGAAA
AAGCGTTTAGATTTCTTATGA


>TTHERM_00294660(protein)
MYAQTLSEALTLNEIIFLKKQIWWTGCTETPFICRGGVYNKNSYLLVITDTRNVWVTKAD
DQQIIDEKDKFNQSIKIKFEDILNTLDTPLRFGRSNTQFTKLQFRKNREEDLIFLMEFQV
GIYPFKWEFFLTKMDDSEIFNILADDLLNPMAKTIMSLEKRGNLYKQKCIQIEKELLRRL
SEKERNTYLSSIDKDNEEVWSNFLIVDSQDDKLTNFDFGPAAQFFLSNHNSKNLIQDQEN
KKITANQQNDIMDNNEDLKRMKLIQDYFSTFEEQPLPNAYLRPDSKKKFKQQEENNQLKY
KQQQLGIKVNYEEQNENKIANEQVQIQIQQNVQKEEKKKKKRLDFL


>TTHERM_00294660(gene)
ATGTACGCTTAAACACTCTCTGAAGCTTTAACTTTGAATGAAATTATTTTTTTAAAAAGT
AAATATGGTCTAATTTAGCAAAATTTGCTATCGTTTATATATAATTAATTTAAAAATTAG
AGTAAATTTGGTGGACTGGCTGTACTGAAACACCATTTATATGTCGTGGAGGAGTTTATA
ATAAAAATAGCTATCTTTTAGGTAAATTGGTTTGATGATATATGCATTATTTATTCATAA
AAGAAAGCTAAGTTGTAGCTATTTTAAATTAACATAATAGTGATCACAGATACACGTAAT
GTATGGGTAACAAAGGCAGATGATTAACAGATTATAGATGAGAAAGATAAATTTAACTAA
TCAATAAAGATAAAATTTGAAGATATTTTGAATACTCTTGATACTCCACTCAGATTTGGT
AGAAGCAATACTTAATTTACAAAGCTATAATTCAGAAAAAATAGAGAAGAAGATCTAATT
TTCTTAATGGAATTTTAAGTAGGAATTTATCCTTTCAAATGGGAGTTCTTTTTAACAAAG
ATGGATGATAGCGAAATTTTTAATATTTTAGCTGATGATTTATTAAATCCTATGGCTAAA
ACAATAATGTCTCTTGAAAAAAGAGGAAACTTGTATAAATAAAAATGTATTCAAATAGAA
AAAGAGTTGTTAAGACGCTTAAGCGAAAAGGAGAGAAATACATATCTTTCCTCCATTGAT
AAAGATAATGAGGAAGTTTGGTCAAATTTCTTAATAGTAGATGTAAATGAAAAAAATAAA
TTACTATTTATCATACAAACTCTATTTGTTGGGTTGGTCAAAAATTTGACCTTTATCTTA
TACCCTCCCTTATTTAATCAACATAATTAATTAATCCTAACCTATTGTTTAAAAAGATAT
TTTTAATTTAAAGTCTTAAGATGATAAACTGACAAATTTTGACTTTGGTCCAGCCGCTTA
ATTCTTTCTGTCAAATCACAACTCCAAAAATTTAAGTAGTCATTTTCAGTAAAAAAGCTA
ATAACTTACTTATTTTTTAATATTAATATTAGTTTAAGATTAAGAAAATAAAAAAATTAC
AGCCAATTAGTAAAATGATATAATGGACAACAACGAAGACTTAAAAAGAATGAAATTAAT
TTAAGATTATTTTAGCACCTTTGAAGAATAGCCTTTGCCAAATGCTTATTTAAGACCAGA
TTCTAAAAAGAAATTTAAATAATAAGAAGAAAACAACTAATTAAAATACAAATAATAATA
GCTAGGTATATTACTTACAACTAGGCTTTTTAATTTTTAAATTAAAATATAACTAAAGGA
ATCAAAGTCAATTATGAAGAATAAAATGAAAATAAAATTGCTAATGAGTAAGTATAAATA
TAAATTTAACAGAATGTTCAAAAAGAAGAAAAGAAAAAGAAAAAGCGTTTAGATTTCTTA
TGA