Identifiers and Description

Gene Model Identifier

TTHERM_000709589

Standard Name

Wdc1 (WD40 domain containing 1)

Aliases

None

Description

Similar to RebL1.Putative ortholog of Arabidopsis thaliana Msi4 (Nabeel-Shah et al. 2021).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_000709589

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17748.19.997093137033517e-262DnaJ domain-containing protein
(1229 aa)
OxytrichaContig8146.0.g582.0001503375893664e-79WD domain, G-beta repeat
DictyBaseDDB_G02825292.0003218023735366e-33rbbD on chromosome: 3 position
5888997 to 5890360
WormBaseWBGene000030365.999781043483669e-32locus:lin-53 Probable histon
e-binding protein lin-53 sta
tus:Confirmed UniProt:P90916
protein_id:CAB03178.1
SGDYEL056W0.00000000000001000191320216021HAT2 Subunit of the Hat1p-Hat2
p histone acetyltransferase co
mplex; required for high affin
ity binding of the complex to
free histone H4, thereby enhan
cing Hat1p activity; similar t
o human RbAp46 and 48; has a r
ole in telomeric silencing
Stentor CoeruleusSteCoe_237880.0000000001026187963170189

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_000709589(coding)
ATGAATATCCCTGATAAATAGTAGAAATGGAAGCTTTATTAATCATATATCTATGATTAT
GTGCTTGACAATAACTTGGATTGGCCTTGTACGACTTGCAGTTGGGGTCCAATCATATCA
GAAAATTCAGAATTATTAAAGCAAAGAGTTTATTTTGCTTGCAGGACTGATGGTATATAT
AATGAAGCTGATACCACTTGGCAAAAACTTCCAAGTTTCCTAGTTGTTGCACAAGTAGAC
ATTCCCTAAGTCGGTAAGCAGTTTAACTAAGAACTGAGAAACGTTTACTTGTAGGATAAT
TTGAAGAAACATAAAAATTTAAAGGTGAAATAAATTATTGTTCACCCGGGAGATGCTAAC
ATGATGAAGAAGTGTAATTTAAATCCTAAATTGTTAGCTACAAAAAATGATGCAAGCTAA
GTGTTTTTATGGGATTTAGATAAACATAGATAGTAAAATTAATTTAGAGATGGTATACAT
GCTAACATGCCTGATCTTACTTTAATAGGACACACAAGCAAGACTCCTAGTTTTGCATTA
GATTGGGCGAAAAATAATTATAGAATTGGTAGTGGAGGTAAAGATTAGAGTGTTTTAATT
TGGGATGTAGATGATTATCAAACTAGACTTACAAGTAATTATATGTAGTAATTTAATACA
CCTTAATTCACAAAAAGAGAATTGAATTCTATTGGAAACTAAAATGAACCTGTTAAGTTG
AAAAATAGCTATTGCCTCACAGGACACACTGACATGATAGAGGATCTATCATTTTCTCCT
GCACACAAAGATGTTCTGGTTAGTGTCGGAGATGACAAAAGACTGATAGGTTGGGATATC
AGGGCTTCTTCAGAAAAGTAATTTGAACTTTTAGATTTGCATGAGGATGACATTAATTGC
GTTGAATGGAGCTTAAAGAACGAAAACTATGTTGCAACAGGCTCTAGCGATGGTAATGCT
GCTCTTATAGACATCAGAAAAATGAAGAAAGTAAGATCTATATTGATTCCTTCAAATGTA
AACCTACCTAGTGATCAATAAAAAAACGCTATTATGAGCATTCGCTTTTAACCATCAAGC
AATTACTTAGCTATAGGCTCAGACAATCTATACATATATAACTTAGATGACCCATAATTT
GATGCTTAGGGAATTGAAAAACCTATGTTTACTCATTTTGGTTAAAAAGGAGTGATTAAT
GATTTTGATTGGAATACAGAAAATCCATGGAGTATTTTAAGTACCTGCTAGGAGTTAGAG
CATGAAACTATGGGAGGTGGTTCGCTTTAAATTTTTAGACCATTAGATTTGGTTTACATG
CCAAAAGAAGAGGCCCTTTAAAAGTTGAAAGAAAATTTAATTGACTATTATTAGAAAGGA
GATAGTAATAAAAACAGTTCTAAACCTAGGACAATGTCAATAATTCTACCCTAATAAAAG
ACTTAATAAACCGAATCTTAACAGAGGATGGATGAAGAAGAAGATAATGAAGATATTCAA
GACGAAGATAATGAAGATGAGGAGGAAGAAGATGAAGTCTAAGAAGCCAGCAGTTCTAAT
GGAAATAATTCAAAGTAAGTTGGTAGCGATAAAATGTAAGTGGAATGA


>TTHERM_000709589(protein)
MNIPDKQQKWKLYQSYIYDYVLDNNLDWPCTTCSWGPIISENSELLKQRVYFACRTDGIY
NEADTTWQKLPSFLVVAQVDIPQVGKQFNQELRNVYLQDNLKKHKNLKVKQIIVHPGDAN
MMKKCNLNPKLLATKNDASQVFLWDLDKHRQQNQFRDGIHANMPDLTLIGHTSKTPSFAL
DWAKNNYRIGSGGKDQSVLIWDVDDYQTRLTSNYMQQFNTPQFTKRELNSIGNQNEPVKL
KNSYCLTGHTDMIEDLSFSPAHKDVLVSVGDDKRLIGWDIRASSEKQFELLDLHEDDINC
VEWSLKNENYVATGSSDGNAALIDIRKMKKVRSILIPSNVNLPSDQQKNAIMSIRFQPSS
NYLAIGSDNLYIYNLDDPQFDAQGIEKPMFTHFGQKGVINDFDWNTENPWSILSTCQELE
HETMGGGSLQIFRPLDLVYMPKEEALQKLKENLIDYYQKGDSNKNSSKPRTMSIILPQQK
TQQTESQQRMDEEEDNEDIQDEDNEDEEEEDEVQEASSSNGNNSKQVGSDKMQVE


>TTHERM_000709589(gene)
ATGAATATCCCTGATAAATAGTAGAAATGGAAGCTTTATTAATCATATATCTATGATTAT
GTGTAAATATAATTTTAAATTTTATAGCTAATATTGAGAGAATAAGTTTTTCATATTTTT
TTTTATCTGTAGGCTTGACAATAACTTGGATTGGCCTTGTACGACTTGCAGTTGGGGTCC
AATCATATCAGAAAATTCAGAATTATTAAAGCAAAGAGTTTATTTTGCTTGCAGGACTGA
TGGTATATATAATGAAGCTGATACCACTTGGCAAAAACTTCCAAGTTTCCTAGTTGTTGC
ACAAGTAGGTAAATAGATTATTTTAGTTGCCGTTATTTGATTAAATGATCTTAAAAAGGC
TTAGAAATTTTAGTATTTTAGAGAAAAGTATAGATTTTAAGAGTTTATATTTAGATAGAA
GATATAAGCAAATATAACCCGCTTCTATTTGAAATTATAAGCATTTGCAAATCAATGAAA
ATATCATTTTGGAGATTTTGAAATGTTTAAAATATATGGACCTAATTATTTGTTTATAAA
TCAAAAGACATTCCCTAAGTCGGTAAGCAGTTTAACTAAGAACTGAGAAACGTTTACTTG
TAGGATAATTTGAAGAAACATAAAAATTTAAAGGTGAAATAAATTATTGTTCACCCGGGA
GATGCTAACATGATGAAGAAGTGTAATTTAAATCCTAAATTGTTAGCTACAAAAAATGAT
GCAAGCTAAGTGTTTTTATGGGATTTAGATAAACATAGATAGTAAAATTAATTTAGAGAT
GGTATACATGCTAACATGCCTGATCTTACGTAATTATTTTACATATTTTTTTATTTATAT
TGTCTCATTTTCTAATTAATATCATAAACAAGCTATTTATAAGGATTTTTAAATTTTAAA
TAAAGTTGGTGTTTATTTGGAATAAGAAAATGATATTTAAATTTTAATAATTTGTTTGTT
TGTTTTATATCAGTTTAATAGGACACACAAGCAAGACTCCTAGTTTTGCATTAGATTGGG
CGAAAAATAATTATAGAATTGGTAGTGGAGGTAAAGATTAGAGTGTTTTAATTTGGGATG
TAGATGATTATCAAACTAGACTTACAAGTAATTATATGTAGTAATTTAATACACCTTAAT
TCACAAAAAGAGAATTGAATTCTATTGGAAACTAAAATGAACCTGTTAAGTTGAAAAATA
GCTATTGCCTCACAGGACACACTGACATGATAGAGGATCTATCATTTTCTCCTGCACACA
AAGATGTTCTGGTTAGTGTCGGAGATGACAAAAGACTGATAGGTTGGGATATCAGGGCTT
CTTCAGAAAAGTAATTTGAAGTAAATTATCTAAGAACCTTCCTTCTTCCCCTAACATTTT
TTCGTTTATTTTAATTAATAGAATTTAAGAAATACTATTTTTAAAAATATTTAATTTCCT
CTTCATGATATTTAAAAATATAATGATAGCTTTTAGATTTGCATGAGGATGACATTAATT
GCGTTGAATGGAGCTTAAAGAACGAAAACTATGTTGCAACAGGCTCTAGCGATGGTAATG
CTGCTCTTATAGACATCAGAAAAATGAAGAAAGTAAGATCTATATTGATTCCTTCAAATG
TAAACCTACCTAGTGATCAATAAAAAAACGCTATTATGAGCATTCGCTTTTAACCATCAA
GCAATTACTTAGCTATAGGCTCAGACAATCTATACATATATAACTTAGTATAGCTTTTCA
TTTTATTTTAATTGAATTTTTATTCAAGTTTAAAATTAAATATTTCAAGGATGACCCATA
ATTTGATGCTTAGGGAATTGAAAAACCTATGTTTACTCATTTTGGTTAAAAGTAAGATAT
CTATTTATTTATTAAAGCAAAACATATAAATATATTAATTATTTTTAAAACAGAGGAGTG
ATTAATGATTTTGATTGGAATACAGAAAATCCATGGAGTATTTTAAGTACCTGCTAGGAG
TTAGAGCATGAAACTATGGGAGGTGGTTCGCTTTAAATTTTTAGACCATTAGATTTGGTT
TACATGCCAAAAGAAGAGGCCCTTTAAAAGTTGAAAGAAAATTTAATTGACTATTATTAG
AAAGGAGATAGTAATAAAAACAGTTCTAAACCTAGGACAATGTCAATAATTCTACCCTAA
TAAAAGACTTAATAAACCGAATCTTAACAGTAATTTATTTAATTTTATCAATTGAGTTAA
TTAAATACAAAATGGATTATTTAGGAGGATGGATGAAGAAGAAGATAATGAAGATATTCA
AGACGAAGATAATGAAGATGAGGAGGAAGAAGATGAAGTCTAAGAAGCCAGCAGTTCTAA
TGGAAATAATTCAAAGTAAGTTGGTAGCGATAAAATGTAAGTGGAATGA