Identifiers and Description

Gene Model Identifier

TTHERM_00997610

Standard Name

WRS2 (Tryptophanyl-tRNA synthetase 2)

Aliases

PreTt24986 | 188.m00062

Description

Tryptophanyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00233 ) tryptophan--tRNA ligase
  • ( PF00579 ) tRNA synthetases class I (W
  • ( PF02189 ) Immunoreceptor tyrosine-based activation motif

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.2%

TetraMine Data

TTHERM_00997610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17419.19.997093137033517e-262tryptophanyl-tRNA synthetase (
1000 aa)
OxytrichaContig4343.0.g463.0006488705143073e-92tRNA synthetases class I (W an
d Y)
DictyBaseDDB_G02745671.0001478224244938e-84mtrpS on chromosome: 2 positio
n 3980092 to 3981225
SGDYDR268W3.999329394025902e-72MSW1 Mitochondrial tryptophany
l-tRNA synthetase
WormBaseWBGene000069461.9999167998962255e-60locus:prx-10 Tryptophan--tRN
A ligase, mitochondrial stat
us:Confirmed UniProt:P46579
protein_id:CCD66648.1
Stentor CoeruleusSteCoe_208541.2995814250075031e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00997610(coding)
ATGAGTGCTAAGAAAATAGCAAGGGATCTCATTTTTTCAGGTATTTAGCCAACAGGAAAG
CTTCATTTAGGAAATTATTTGGGTGCCATTTAAAACTGGGTAAAACTACAAGAAAAATAT
CATGAAAAATCAGATATTTTCTTTTGTATAGTTGATTAGCATGCACTAACCGATAAATTT
AAAATAGATCATTAGATCTACTTTGAAGATACAACTAAAGATAACACTATTATAATGGCA
GCTGCTTTATTAGCATCTGGAATAGATCCCAAAAAATCTAACATTTTCGTTTAATCAGCT
GTTCCTTATCATGCAGAGCTTTAATGGATGTTAGGATGTATTGCTCCTCAAAATTGGTTA
AATACAATGACTTAATATAAAGATAAAAAATCAAAAAACTCTAGTTTGGGTTTATATTCT
TACCCTGTTCTCATGGCAGCTGATATTTTACTTTACAATGCTACTCATGTTCCTGTTGGA
AGCGATTAAAAGCAGCATTTAGAGTTAACTAGAGACTATGCTACAAGGTTCAATACATTA
TTTAAAAATGATAAAACATAGGGTATTTCAATGCCTTAATACATAGAATCTGAATTTCCT
AGAGTAATGAGTCTTAAAGATGGTACTAAAAAAATGTCTAAATCAGATCCTAGTGATTTT
TCTAGAATTAACTTGACTGATACTCCTGAAGTAGTTTATGACAAGATCAAAAAAGCTAAA
ACTGACTCAATCCCTATTGTTAAATTAGATCCAAACAGACCTGAAGTAACTAATCTTATT
AGAATATATAGCTCTTTATCTGGTTAGAGTATCAAAGAAATTGAAGCTACTTTTTCATCA
AGCTCTATGAAAGATTTTAAAGACAAACTCTCTGAGCTTATTATTACAAAAGTTTGCCCA
ATTGGTTTAAGAATAGAAGATCTATTATCAAACTAAGACTACGTTTACGAGTCTTTAAAG
CAAGGTAACGAAAGAGCTTACGATAGAGCCAAAGAAAATATTCAAAGAATAAAAAAAGAG
ATGGGAATGTATGTTATGTGA


>TTHERM_00997610(protein)
MSAKKIARDLIFSGIQPTGKLHLGNYLGAIQNWVKLQEKYHEKSDIFFCIVDQHALTDKF
KIDHQIYFEDTTKDNTIIMAAALLASGIDPKKSNIFVQSAVPYHAELQWMLGCIAPQNWL
NTMTQYKDKKSKNSSLGLYSYPVLMAADILLYNATHVPVGSDQKQHLELTRDYATRFNTL
FKNDKTQGISMPQYIESEFPRVMSLKDGTKKMSKSDPSDFSRINLTDTPEVVYDKIKKAK
TDSIPIVKLDPNRPEVTNLIRIYSSLSGQSIKEIEATFSSSSMKDFKDKLSELIITKVCP
IGLRIEDLLSNQDYVYESLKQGNERAYDRAKENIQRIKKEMGMYVM


>TTHERM_00997610(gene)
AACAATTTATACTAAAATTAATTAAAAAAAGATCTACTTATCAAAATAGGTATTAACATC
ATGAGTGCTAAGAAAATAGCAGTAATTATTAAGTCTAACAAATTCATAAATAAAATATAT
CATTTATAAAATTAACCAGAGGGATCTCATTTTTTCAGGTATTTAGCCAACAGGAAAGCT
TCATTTAGGAAATTATTTGGGTGCCATTTAAAACTGGGTAAAACTACAAGAAAAATATCA
TGAAAAATCAGATATTTTCTTTTGTATAGTTGATTAGCATGCACTAACCGATAAATTTAA
AATAGGTAAAATCAACTTTATAATTATAGATAAATACATTCTTTATTGAATGCATTAAAC
AAAATATTTTCTAAATTTAAATTATTTTTTTAAGTATAAATTGGATTTGAGACTAATCAC
TATTTTTTAATGAAAAAATAAAATAGATCATTAGATCTACTTTGAAGATACAACTAAAGA
TAACACTATTATAATGGCAGCTGCTTTATTAGCATCTGGAATAGATCCCAAAAAATCTAA
CATTTTCGTTTAATCAGCTGTAATTTCAAAATTTAATTTTATGTGTTTTTTATTTGCATG
TAACAAACCTAATTATTTGTATAAATATTATTATTATAAAGGTTCCTTATCATGCAGAGC
TTTAATGGATGTTAGGATGTATTGCTCCTCAAAATTGGTTAAATACAATGACTTAATATA
AAGATAAAAAATCAAAAAACTCTAGTTTGGGTTTATATTCTTACCCTGTTCTCATGGCAG
CTGATATTTTACTTTACAAGTAATTAGTTAATGATTTATTTATTTATTTACTTATTTAGC
CAAATCTTTTTGTTAATAATAATATCTTTCTAGAAATATTAATAATTAATTATTTTCGTA
AACAAATTCTAATTTTTTAAATAGTGCTACTCATGTTCCTGTTGGAAGCGATTAAAAGCA
GCATTTAGAGTTAACTAGAGACTATGCTACAAGGTTCAATACATTATTTAAAAATGATAA
AACATAGGGTATTTCAATGCCTTAATACATAGAATGTAATTCAATAAAATTCCATGAAAT
AGTTAATTTAATATAAATTTTTTAAATAATACAAGCTGAATTTCCTAGAGTAATGAGTCT
TAAAGATGGTACTAAAAAAATGTCTAAATCAGATCCTAGTGATTTTTCTAGAATTAACTT
GACTGATACTCCTGAAGTAGTTTATGACAAGATCAAAAAAGCTAAAACTGACTCAATCCC
TATTGTATTTAAAAGCAATATTTAAAAATCTTCTTATTCATTTTTTATTAATAAAGGTTA
AATTAGATCCAAACAGACCTGAAGTAACTAATCTTATTAGAATATATAGCTCTTTATCTG
GTTAGAGTATCAAAGAAATTGAAGCTACTTTTTCATCAAGCTCTATGAAAGATTTTAAAG
ACAAACTCTCTGAGCTTATTATTACAAAGTAAATAAAATTAATTTTTTAATTAGCATTAA
TTAAATAATATTTTTATTATTCATTTATTTAACTAATAATAAATAATTCTTTATTTTTTA
ATTAGAGTTTGCCCAATTGGTTTAAGAATAGAAGATCTATTATCAAACTAAGACTACGTT
TACGAGTCTTTAAAGCAAGGTAACGAAAGAGCTTACGATAGAGCCAAAGAAAATATTCAA
AGAATAAAAAAAGAGATGGGAATGTATGTTATGTGATGGATAAATATTTATAAAATAACT
ATTTATATTTGATT