Identifiers and Description

Gene Model Identifier

TTHERM_00500890

Standard Name

WRS1 (tryptophanyl-tRNA synthetase)

Aliases

PreTt08033 | 63.m00211 | 3716.m00064

Description

tryptophanyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00500890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09641.19.997093137033517e-262tryptophanyl-tRNA synthetase (
418 aa)
OxytrichaContig20174.0.g346.9967425661821976e-158tRNA synthetases class I (W an
d Y)
DictyBaseDDB_G02694543.001476460448119e-154trpS on chromosome: 1 position
2807320 to 2808805
WormBaseWBGene000069454.000516897438123e-146locus:wars-1 status:Confirme
d UniProt:G5EDY2 protein_i
d:CAB60439.2
SGDYOL097C3.001062636953563e-123WRS1 Cytoplasmic tryptophanyl-
tRNA synthetase, aminoacylates
tryptophanyl-tRNA
Stentor CoeruleusSteCoe_30539.710436457780846e-67

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00500890(coding)
ATGTCAACTCAACAATAAGAAACTGTTGTCGAAGAACAAAAAGTTCAATAGCCAACTGAA
GGAGAATAAGAAGATTAAGTCAAGCCATCCTCTGTAAACCCTTATGAAGTTGGTGAAAAT
GTTGATTACGATAAGCTTATATCTGAATTTGGATGCTCAAAGATTGATTAAAGTTTAATT
GATAGAGTTGAAAAGCTTACTGGAAAGAAGGCACATCCATTTTTGACAAGAGAAATCTTC
TTCTCTCATAGAGACTTAAATTTAATTTTAGATAATTATGAAAAGGGAATCCCTTTCTAT
CTTTACACTGGTAGAGGTCCTTCCACTGAATCTATGCACTTGGGTCACTTGATGCCTTTC
ATCTTCACTAAATATTTGTAAGATGCTTTTGATGTTCCTTTGGTTATTTAATTGACTGAT
GATGAAAAGTTCTTCCATAAGGGAGATTTTACTTTAGAAGAATACCAAAAGTTAGCTATT
GAAAATGCTAAGGATATTATAGCTTGTGGTTTCGATATTGAAAAAACTTTTATTTTCAGA
AATACTGATTATGTTGGTCATATGTACCCAAATATTTGCAAAATTCAAAAGGCTGTTACT
TACAATCAACTTAAGGGTATTTTTGGTGTAACTCCAAGTGATAATTGTGGTAAATTTGCT
TTCCCAGCAGTTCAAGCCGCTCCTGCCATATCTACTTCTTTCCCTCACATTTTCGGTAAT
AAGAACGTTTTCTGCTTAATCCCCTAAGGTATTGACTAAGATCCATACTTTAGAATGACT
AGAGATGTTTAATATAAGCTCAAGGTTCCAAAAACTGCTTGCATCCACAGCAAATTTTTC
CCATCTTTACAAGGTTTTGGTACTAAGATGGGTAGCACAGTTCCTAACAGTGCTATTTTC
TTGACAGATACTCCCAAGCAAATTAAAGAAAAAATTAATAAATCAGTAAGTGGAGGTAGA
GCTACTAAAGAAGAATAAGAATAATTCGGTGCAGATTTAACAGTAGATATCCCCTATCAC
TATCTTAGATTCTTCTTAGAAGACGATGCTAGATTAGAAGAAATTAGAGTTAAGTATAGC
ACTGGTAAGATGTTAACTGGTGAAGTAAAGAAGGAATTAATAGGAATCTTACAAAAGATT
ATTGGTGATCACCAAGAAAAGAGAAAGGCTATCACTAATGATAAGGTTTTAGAGTACATG
AAAATCAGACCTCTTAAATTCAAAACACCCTAAAACCAACTTGAAGCCAAACAAGAACAA
TGA


>TTHERM_00500890(protein)
MSTQQQETVVEEQKVQQPTEGEQEDQVKPSSVNPYEVGENVDYDKLISEFGCSKIDQSLI
DRVEKLTGKKAHPFLTREIFFSHRDLNLILDNYEKGIPFYLYTGRGPSTESMHLGHLMPF
IFTKYLQDAFDVPLVIQLTDDEKFFHKGDFTLEEYQKLAIENAKDIIACGFDIEKTFIFR
NTDYVGHMYPNICKIQKAVTYNQLKGIFGVTPSDNCGKFAFPAVQAAPAISTSFPHIFGN
KNVFCLIPQGIDQDPYFRMTRDVQYKLKVPKTACIHSKFFPSLQGFGTKMGSTVPNSAIF
LTDTPKQIKEKINKSVSGGRATKEEQEQFGADLTVDIPYHYLRFFLEDDARLEEIRVKYS
TGKMLTGEVKKELIGILQKIIGDHQEKRKAITNDKVLEYMKIRPLKFKTPQNQLEAKQEQ


>TTHERM_00500890(gene)
ATGTCAACTCAACAATAAGAAACTGTTGTCGAAGAACAAAAAGTTCAATAGCCAACTGAA
GGAGAATAAGAAGATTAAGTAATAAATTTAAATTTATAGATAAGATAGATTTATTATCTG
CTCAAACTTTAAAAGATTAAATCATTTTTGCTAAACTAATTAGGTCAAGCCATCCTCTGT
AAACCCTTATGAAGTTGGTGAAAATGGTAAACAATTTTAGCTAATAAAGTTAAAGAAAAG
GGAAATAACTATTAATTTTATATATATATAGTTGATTACGATAAGCTTATATCTGAATTT
GGATGCTCAAAGATTGATTAAAGTTTAATTGATAGGTAATGAATTCATTTTTTTAAACAT
AGTTTTTCAATATTCACCTGTACATATATATTATTCTAGAGTTGAAAAGCTTACTGGAAA
GAAGGCACATCCATTTTTGACAAGAGAAATCTTCTTCTCTCATAGAGACTTAAATTTAAT
TTTAGATAATTATGAAAAGGGAATCCCTTTCTATCTTTACACTGGTAGAGGTAAATAAAT
AAATAAATCAATATTTATAGAATAGGAAAGTAAAGCTACTTAATTTTTAAAAAGGTCCTT
CCACTGAATCTATGCACTTGGGTCACTTGATGCCTTTCATCTTCACTAAATATTTGTAAG
ATGCTTTTGATGTTCCTTTGGTTATTTAATTGACTGATGATGAAAAGTTCTTCCATAAGG
GAGATTTTACTTTAGAAGTAAAATTTTATAAAATCAAAAATTGTTAAATTTAACTTTGAA
AAATTATTAAATAAAAGGAATACCAAAAGTTAGCTATTGAAAATGCTAAGGATATTATAG
CTTGTGGTTTCGATATTGAAAAAACTTTTATTTTCAGAAATACTGATTATGTTGGTCATA
TGTACCCAAATATTTGCAAAATTCAAAAGGCTGTTACTTACAATCAAGTAAAATAAAATA
TTATTTACATTTTTAAATAAAGATGAAATAATAATTATAGGAATTAATTTTTAATTTATT
TTATAAAAAAGCTTAAGGGTATTTTTGGTGTAACTCCAAGTGATAATTGTGGTAAATTTG
CTTTCCCAGCAGTTCAAGCCGCTCCTGCCATATCTACTTCTTTCCCTCACATTTTCGGTA
ATAAGAACGTTTTCTGCTTAATCCCCTAAGGTATTGACTAAGATCCATACTTTAGAATGA
CTAGAGATGTTTAATATAAGCTCAAGGTTCCAAAAACTGCTTGCATCCACAGCAAATTTT
TCCCATCTTTACAAGGTTTTGGTACTAAGATGGGTAGCACAGTTCCTAACAGTGCTATTT
TCTTGACAGATACTCCCAAGCAAATTAAAGAAAAAATTAATAAATCAGTAAGTGGAGGTA
GAGCTACTAAAGAAGAATAAGAATAATTCGGTGCAGATTTAACAGTAGATATCCCCTATC
ACTATCTTAGATTCTTCTTAGAAGACGATGCTAGATTAGAAGAAATTAGAGTTAAGTATA
GCACTGGTAAGATGTTAACTGGTGAAGTAAAGAAGGAATTAATAGGAATCTTACAAAAGA
TTATTGGTGATCACCAAGTAATAATTATTTTATATTATATTTCAAATAAATAAATACATT
TTTTTAAAATAGGAAAAGAGAAAGGCTATCACTAATGATAAGGTTTTAGAGTACATGAAA
ATCAGACCTCTTAAATTCAAAACACCCTAAAACCAACTTGAAGCCAAACAAGAACAATGA