Identifiers and Description

Gene Model Identifier

TTHERM_00146080

Standard Name

WEE1 (WEE1-like protein kinase)

Aliases

PreTt26815 | 11.m00512 | 3702.m00234

Description

Protein kinase domain containing protein; wee protein kinase family

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01163 ) RIO1 family
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF05445 ) Poxvirus serine/threonine protein kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00146080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04666.19.997093137033517e-262protein kinase domain-containi
ng protein (680 aa)
OxytrichaContig10870.0.g289.998397555368434e-52Protein kinase domain
WormBaseWBGene000069402.00017271388466e-38locus:wee-1.3 Membrane-assoc
iated tyrosine- and threonine-
specific cdc2-inhibitory kinas
e wee-1.3 status:Confirmed
UniProt:O18209 protein_id:C
AB16484.1
DictyBaseDDB_G02918421.9994920269952867e-34DDB_G0291842 on chromosome: 6
position 822502 to 823633
Stentor CoeruleusSteCoe_312334.780892883885469e-25
SGDYHR102W4.0006511639687014e-23KIC1 Protein kinase of the PAK
/Ste20 family, required for ce
ll integrity; physically inter
acts with Cdc31p (centrin), wh
ich is a component of the spin
dle pole body; part of the RAM
network that regulates cellul
ar polarity and morphogenesis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00146080(coding)
ATGCTATCGACTCCTAAAAAGAGTACATATAAAACAAAAATGGAAGAAGGATACGCCTCT
CCTCCTTCTAAAAGAGACACCGAAAAAGCGAATAAATACCTTTACTCAAAGGAATAGTAT
ATAAACAGTAGCAATACTAAGAAAAATAACTTCATAAGCCATTTTGATAACACAGCAAAA
CCACATTTACATGGGACTAATGAAAATTCTAAAACTAAAAAAACTTAATTTAACTTTGAG
AGCATTGTTAAACCTAATTATGGAATTACTTTAACATAAACACCAAATGTTTAAAAAAAT
CTGCCTTCATATGAAAAAATTCCATAGCAAAGGCTTTTCACTTAATAGATAAATAAATAT
AACACTAAAAATGAATTTGATCATTCAACTCCCAAAAAATAGCATAATTATAAAAAATCT
TTATTCTCCTCTGATTCGTAAGAGAGTAGTACTGAAAGAGAGAATGATAATCATTATTAC
TCGAATTAAAACAAAGAAAATGATTCTCATTCAAAGAATAAAAAAAATAATCGTAATCAT
ATATTTGCAGTTTCTGAAGTTCCAGCATAAAAAAGGCAAAATTAAATAAGCCAACTTTAA
AAGAGCGCAAGAAAAGTTAATCCTTTTACATCTAACGAGACACTAACAAATAAAAATTAA
GTGATAGTGGCACCTTTTGATAGAGAAAACAGGCAAATGAACATGACTATCCATTAAAGA
GACAATAAAAAAGTATCTATAAATGCTGTGAATCATCTTAATAACAATAAAAATGCTAAT
TAAATACTTCTCCCTTCACCTAAAGAGTTTAAATAGTTAAATTCCACTCACAAAATAGAT
CATTAGAGCCCTCATGTCAACTGTTTCACAAATCAAATAATGAATTCAGCTAATTAAAAG
CATTAAATAAATAGAAGTAATACATCTAATAGCGATAGTAATAATGAATAAAATAATAAT
AGTATATCTAGCTTTAGTATAAATTCAGGTAGAAGCTGTAATTATGGTAACAATAATAAT
AGTAACAACATTCTCAATCAAACACCTTCAAAAAATAATAATTAGAATAATTCTAAAGCA
AGTTCTTAACCTTTTTTTGAAGAAGAAATGGACAGATTTGAATAAGATTATGAGGTTCTA
TAAGTTTTAGGCAGTGGATTCTTTGGTACTGTTTATAAATGTCAAAATAGGATAGATAAA
AATATTTATGCAGTAAAAGTGACTAAAGAATAAATAAGAGGAGAAAATTCTCAAAAATAG
ATTTTAAAAGAAGCTTAAGCTCTTGCATCTTTAAGTGCATGCGATGAGGTAGAATATATA
GTTTGTTATCATAGTGCTTGGATAGAAGACAGATAGCTACATTTAGCTATGGAATTTTGT
GATAGCAACTTAGCAAACTTTCCTTTACCCTAACCTCCTAACTATAATTAGTTCTATTAA
ATGATTAAGAAAATTTTCTAAGATGTAGTTAAAGGATTACATTATTTGCATTAATAGAAT
TTAGTTCACCTTGATTTAAAACCTGAAAACATCTTATATAACAAAAAGTAAAATAAGTTT
AAAATAGCTGATTTAGGGCTTGCTTTAATTGCAAATAAGGACAACGAAAAATATAACTAA
ATTGAAGAGGGAGATGCTAGATACCTAGCAAAAGAAATTTTAAATTATTATGAAGCTGTT
GATCTTAAAAAAGCAGATATATTTTCTTTAGGGGCAATGATGTATCATCTAGTAACTTAA
GAATAACTTCCAACCAATGGTGATGAATGGCTGCAAATAAGATAGGGGCATTTACCTAAC
TTAGACTCATTGAATTAATGTCCAAAAGAGCTGAAATAAATGATAAGATAAATGATGAAT
CCTGATCCAGAATTAAGATTATCAACATAAGAAATTTTAGATTCTTCATATATGAAATCA
CATTTAATTAATGAAATAAAATGGTAAAAAATATTGAAAAATTTACTACTCATCTCAATT
CAAAAATTGGAAAAAAATTAATAAACCTAACAAATTACTAGAAGAAAATCACTTCCCATC
CTTAAAAAAATAAATTTTATATGA


>TTHERM_00146080(protein)
MLSTPKKSTYKTKMEEGYASPPSKRDTEKANKYLYSKEQYINSSNTKKNNFISHFDNTAK
PHLHGTNENSKTKKTQFNFESIVKPNYGITLTQTPNVQKNLPSYEKIPQQRLFTQQINKY
NTKNEFDHSTPKKQHNYKKSLFSSDSQESSTERENDNHYYSNQNKENDSHSKNKKNNRNH
IFAVSEVPAQKRQNQISQLQKSARKVNPFTSNETLTNKNQVIVAPFDRENRQMNMTIHQR
DNKKVSINAVNHLNNNKNANQILLPSPKEFKQLNSTHKIDHQSPHVNCFTNQIMNSANQK
HQINRSNTSNSDSNNEQNNNSISSFSINSGRSCNYGNNNNSNNILNQTPSKNNNQNNSKA
SSQPFFEEEMDRFEQDYEVLQVLGSGFFGTVYKCQNRIDKNIYAVKVTKEQIRGENSQKQ
ILKEAQALASLSACDEVEYIVCYHSAWIEDRQLHLAMEFCDSNLANFPLPQPPNYNQFYQ
MIKKIFQDVVKGLHYLHQQNLVHLDLKPENILYNKKQNKFKIADLGLALIANKDNEKYNQ
IEEGDARYLAKEILNYYEAVDLKKADIFSLGAMMYHLVTQEQLPTNGDEWLQIRQGHLPN
LDSLNQCPKELKQMIRQMMNPDPELRLSTQEILDSSYMKSHLINEIKWQKILKNLLLISI
QKLEKNQQTQQITRRKSLPILKKINFI


>TTHERM_00146080(gene)
GATAGATTCAAATGATATTTATATATGTATAATTTGTTATTAATATTAATTGTTTACACG
CAAATTTAGGTAAATAATAAAAATAGCAACACAATTCTAAAATTTATATAATAAATAATT
TAGAATTTTAACCATTTTTATAACAAGTTTAGCCATGCTATCGACTCCTAAAAAGAGTAC
ATATAAAACAAAAATGGAAGAAGGATACGCCTCTCCTCCTTCTAAAAGAGACACCGAAAA
AGCGAATAAATACCTTTACTCAAAGGAATAGTATATAAACAGTAGCAATACTAAGAAAAA
TAACTTCATAAGCCATTTTGATAACACAGCAAAACCACATTTACATGGGACTAATGAAAA
TTCTAAAACTAAAAAAACTTAATTTAACTTTGAGAGCATTGTTAAACCTAATTATGGAAT
TACTTTAACATAAACACCAAATGTTTAAAAAAATCTGCCTTCATATGAAAAAATTCCATA
GCAAAGGCTTTTCACTTAATAGATAAATAAATATAACACTAAAAATGAATTTGATCATTC
AACTCCCAAAAAATAGCATAATTATAAAAAATCTTTATTCTCCTCTGATTCGTAAGAGAG
TAGTACTGAAAGAGAGAATGATAATCATTATTACTCGAATTAAAACAAAGAAAATGATTC
TCATTCAAAGAATAAAAAAAATAATCGTAATCATATATTTGCAGTTTCTGAAGTTCCAGC
ATAAAAAAGGCAAAATTAAATAAGCCAACTTTAAAAGAGCGCAAGAAAAGTTAATCCTTT
TACATCTAACGAGACACTAACAAATAAAAATTAAGTGATAGTGGCACCTTTTGATAGAGA
AAACAGGCAAATGAACATGACTATCCATTAAAGAGACAATAAAAAAGTATCTATAAATGC
TGTGAATCATCTTAATAACAATAAAAATGCTAATTAAATACTTCTCCCTTCACCTAAAGA
GTTTAAATAGTTAAATTCCACTCACAAAATAGATCATTAGAGCCCTCATGTCAACTGTTT
CACAAATCAAATAATGAATTCAGCTAATTAAAAGCATTAAATAAATAGAAGTAATACATC
TAATAGCGATAGTAATAATGAATAAAATAATAATAGTATATCTAGCTTTAGTATAAATTC
AGGTAGAAGCTGTAATTATGGTAACAATAATAATAGTAACAACATTCTCAATCAAACACC
TTCAAAAAATAATAATTAGAATAATTCTAAAGCAAGTTCTTAACCTTTTTTTGAAGAAGA
AATGGACAGATTTGAATAAGATTATGAGGTTCTATAAGTTTTAGGCAGTGGATTCTTTGG
TACTGTTTATAAATGTCAAAATAGGATAGATAAAAATATTTATGCAGTAAAAGTGACTAA
AGAATAAATAAGAGGAGAAAATTCTCAAAAATAGATTTTAAAAGAAGCTTAAGCTCTTGC
ATCTTTAAGTGCATGCGATGAGGTAGAATATATAGGTAAATTGTTTAAATTATTTTTAAT
GCAAAAAATAACTCAATTTTGTTGTGTTTTAGATTCTATAAATTCAAATTTAATTATAAT
TTTAACCAAATTATTTTATTATAAAAGTTTGTTATCATAGTGCTTGGATAGAAGACAGAT
AGCTACATTTAGCTATGGAATTTTGTGATAGCAACTTAGCAAACTTTCCTTTACCCTAAC
CTCCTAACTATAATTAGTTCTATTAAATGATTAAGAAAATTTTCTAAGATGTAGTTAAAG
GATTACATTATTTGCATTAATAGAATTTAGTTCACCTTGATTTAAAACCTGAAAACATCT
TATATAACAAAAAGTAAAATAAGTTTAAAATAGCTGATTTAGGGCTTGCTTTAATTGCAA
ATAAGGACAACGAAAAATATAACTAAATTGAAGAGGGAGATGCTAGATACCTAGCAAAAG
AAATTTTAAATTATTATGAAGCTGTTGATCTTAAAAAAGCAGATATATTTTCTTTAGGGG
CAATGATGTATCATCTAGTAACTTAAGAATAACTTCCAACCAATGGTGATGAATGGCTGC
AAATAAGATAGGGGCATTTACCTAACTTAGACTCATTGAATTAATGTCCAAAAGAGCTGA
AATAAATGATAAGATAAATGATGAATCCTGATCCAGAATTAAGATTATCAACATAAGAAA
TTTTAGATTCTTCATATATGAAATCACATTTAATTAATGAAATAAAATGGTAAAAAATAT
TGAAAAATTTACTACTCATCTCAATTCAAAAATTGGAAAAAAATTAATAAACCTAACAAA
TTACTAGAAGAAAATCACTTCCCATCCTTAAAAAAATAAATTTTATATGAAAGTAAAATT
ATTATTGACTTTAACAAATCTAATAACAACAACAAAATAAATAAACAAAGGACAATAAAT
ATTTCTTATACATACTTTATAAAAAACCAAAATTAATTATAGTTGAAAAAAATGAATTAA
AATTTTTGATAAAATAAAAAATAAATAAGTTTGAAGATAATATATTTATATTATTAATTC
CACTATAAAATATTAAAAATTTAAAGTTTAATTATTAAATCATTCATAGATTATTTATAA
CCGTATTTATATCACATATAATTGTATTCAAATATCTTAAATTAACAATTTAAAACACAA