Identifiers and Description

Gene Model Identifier

TTHERM_00433690

Standard Name

WDR5 (WD-repeat protein 5)

Aliases

PreTt26510 | 48.m00273 | 3831.m01609

Description

WDR5 WD domain G-beta repeat protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00433690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04207.19.997093137033517e-262hypothetical protein (322 aa)
DictyBaseDDB_G02872732.0008113830639685e-30wdr5 on chromosome: 5 position
72820 to 74155
WormBaseWBGene000105725.998760051700188e-30locus:wdr-5.2 Uncharacterize
d WD repeat-containing protein
K04G11.4 status:Partially_c
onfirmed UniProt:Q93847 pr
otein_id:CAB01760.1
OxytrichaContig21435.0.g57.996806159126539e-24WD domain, G-beta repeat
SGDYPR178W0.000000000000001999258566166494PRP4 Splicing factor, componen
t of the U4/U6-U5 snRNP comple
x

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00433690(coding)
ATGATGGAGGAAGAATTTAAAAACTATAAAATAACTATTTAAGAATAAAACTTAGTGACA
AGCATGATATCATAGTTTGATTAAAAATTGATTAAAATATAATAGAATGATTAGAATACT
ATAGCTTGTTGCTTTACTGATGGTAAAGTGGAGATATTTGGCAAAGAAAACTGTGAAAAT
TTCGATCTTAAACCAGATGTAACAGATGCCGTTACTGATTTGTTATGGTTCGATTAAAAT
CACCTTCTTTGTAGTCAAGATAAAGTTATTCATATTTTTGATATAGAGAAGAAATAATCA
ATAGTTGAGCTTTAGGGCCATTCATAGACTATTTTTTGTGTATGCAAGAACTTCTACAAT
AATTTAATAGCATCTGCTGGATAAGATAATACGATTATGATGTGGGATATTAGACAGAAG
AAACCTATCAATTTAATTTTGGCTCACTCTCGTAGTATAACTTCCCTTTAATTTTCTAAA
GATAGTATGAATGTTGTGAGTTGTGGTGCAGATGGCTTTACGAGAGTTTTCAGTACTCAC
ACAGGGTTGTGCAGATGCACACTCAATTCAGACACAACAAGTGTTCCTGCATTTGTTAAG
TTTGCAGACAATAATTAGTTTTTACTTGTGGATACATTAGCAAATAAAATTTAGCTTTGG
GATTGGCACCAATAAGAACTGAGATAAGTTTATACTGGAATACAAAATGATAAAGCTTAC
TTAGAGAGCTTCATGATAAGAGATAAGTACAGTAACAAGTAAAGATTTATTCTAGGATTT
TCTGAGAATAATTAAATCATAGTCTGGGATCTCCTAACTGGAAAAATACTTAAAAATTAA
AAAATTAAATCAGATACCTCATTAAAATTATATTAAAAAGACGGTTTATAGTCAAATGGA
TTTTATTTATATGGAAACGATACCCACGAAATGTTCTAATATTCTATTGATATATCACTT
ACCGACTGA


>TTHERM_00433690(protein)
MMEEEFKNYKITIQEQNLVTSMISQFDQKLIKIQQNDQNTIACCFTDGKVEIFGKENCEN
FDLKPDVTDAVTDLLWFDQNHLLCSQDKVIHIFDIEKKQSIVELQGHSQTIFCVCKNFYN
NLIASAGQDNTIMMWDIRQKKPINLILAHSRSITSLQFSKDSMNVVSCGADGFTRVFSTH
TGLCRCTLNSDTTSVPAFVKFADNNQFLLVDTLANKIQLWDWHQQELRQVYTGIQNDKAY
LESFMIRDKYSNKQRFILGFSENNQIIVWDLLTGKILKNQKIKSDTSLKLYQKDGLQSNG
FYLYGNDTHEMFQYSIDISLTD


>TTHERM_00433690(gene)
ATGATGGAGGAAGAATTTAAAAACTATAAAATAACTATTTAAGAATAAAACTTAGTGACA
AGCATGATATCATAGTTTGATTAAAAATTGATTAAAATATAATAGAATGATTAGAATACT
ATAGCTTGTTGCTTTACTGATGGTAAAGTGGAGATATTTGGCAAAGAAAACTGTGAAAAT
TTCGATCTTAAACCAGATGTAACAGATGCCGTTACTGATTTGTTATGGTTCGATTAAAAT
CACCTTCTTTGTAGTCAAGATAAAGTTATTCATATTTTTGATATAGAGAAGAAATAATCA
ATAGTTGAGCTTTAGGGCCATTCATAGACTATTTTTTGTGTATGCAAGAACTTCTACAAT
AATTTAATAGCATCTGCTGGTAATTATTTGATTAATTTTCAATTTTTTAATGCATATTCA
ACAAAAACATTTATTATTTCAAGTATTTTGTTTAAAAATCAACATACAAGTTAATTAGTA
TGCAAATTAGCTTATGAGTGAATTAGTTAGTTATTTAGTTTATTGGCAAAGTTGCGCGAG
AATTTAAATTTATTAACAGAAAAAATAAAATCATTAATTAGTAGATAAATTAATGATAAA
GTTTATTGTGAAAACATTTTTGAACAAAATAATAAGCCAAATGAACTGGCTTAAAGTATA
TATTTAGGCATATAAATCTTAACTCAATATGATTTATTATCAAATCTATTAAAATTATTT
ACCAATTTGGTAGCAGGATTATTTTTTCTCCCTATTCATTTAGCAATTTTGTAAATATTC
TGAATTTAAATAATTTTAAAGAAAATAAAAGAATGAAAGCTTAAGCACAAATAAATAAAT
AAATAATCAGTTTAAAATGATTTTGAAAATAGCAGTAAAAAAAAATAGATTTTATGAAAA
TAATAAATGAATTGATGGAGTTATTAATAGAATTGTAAAATAATATTTAGGATTTAATTA
ATACTTAATAGGTAATTAACTTGATAAATAAATAAAAATACAGATAGAAAGTAAATTTCC
TAGTTAGATAATTAGATAAATAAATAGACACAATATTTTAAGAAAATAATAATTTTTAAA
TATTTGTTAAATGATGAAATATTAGTGAATTAAATGCATATTAAAATTATTTTATTTTTT
AGATATTATTTTTAACTAATTTAACAAATTTTATAATAGGATAAGATAATACGATTATGA
TGTGGGATATTAGACAGAAGAAACCTATCAATTTAATTTTGGCTCACTCTCGTAGTATAA
CTTCCCTTTAATTTTCTAAAGATAGTATGAATGTTGTGAGTTGTGGTGCAGATGGCTTTA
CGAGAGTTTTCAGTACTCACACAGGGTTGTGCAGATGCACACTCAATTCAGACACAACAA
GTGTTCCTGCATTTGTTAAGTTTGCAGACAATAATTAGTTTTTACTTGTGGATACATTAG
CAAATAAAATTTAGCTTTGGGATTGGCACCAATAAGAACTGAGATAAGTTTATACTGGAA
TACAAAATGATAAAGCTTACTTAGAGAGCTTCATGATAAGAGATAAGTACAGTAACAAGT
AAAGATTTATTCTAGGATTTTCTGAGAATAATTAAATCATAGTCTGGGATCTCCTAACTG
GAAAAATACTTAAAAATTAAAAAATTAAATCAGATACCTCATTAAAATTATATTAAAAAG
ACGGTTTATAGTCAAATGGATTTTATTTATATGGAAACGATACCCACGAAATGTTCTAAT
ATTCTATTGATATATCACTTACCGACTGA