Identifiers and Description

Gene Model Identifier

TTHERM_00433690

Standard Name

WDR5 (WD-repeat protein 5)

Aliases

PreTt26510 | 48.m00273 | 3831.m01609

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00433690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04207.19.997093137033517e-262hypothetical protein (322 aa)
DictyBaseDDB_G02872732.0008113830639685e-30wdr5 on chromosome: 5 position
72820 to 74155
WormBaseWBGene000105725.998760051700188e-30locus:wdr-5.2 Uncharacterize
d WD repeat-containing protein
K04G11.4 status:Partially_c
onfirmed UniProt:Q93847 pr
otein_id:CAB01760.1
OxytrichaContig21435.0.g57.996806159126539e-24WD domain, G-beta repeat
SGDYPR178W0.000000000000001999258566166494PRP4 Splicing factor, componen
t of the U4/U6-U5 snRNP comple
x

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00433690(coding)
ATGATGGAGGAAGAATTTAAAAACTATAAAATAACTATTTAAGAATAAAACTTAGTGACA
AGCATGATATCATAGTTTGATTAAAAATTGATTAAAATATAATAGAATGATTAGAATACT
ATAGCTTGTTGCTTTACTGATGGTAAAGTGGAGATATTTGGCAAAGAAAACTGTGAAAAT
TTCGATCTTAAACCAGATGTAACAGATGCCGTTACTGATTTGTTATGGTTCGATTAAAAT
CACCTTCTTTGTAGTCAAGATAAAGTTATTCATATTTTTGATATAGAGAAGAAATAATCA
ATAGTTGAGCTTTAGGGCCATTCATAGACTATTTTTTGTGTATGCAAGAACTTCTACAAT
AATTTAATAGCATCTGCTGGATAAGATAATACGATTATGATGTGGGATATTAGACAGAAG
AAACCTATCAATTTAATTTTGGCTCACTCTCGTAGTATAACTTCCCTTTAATTTTCTAAA
GATAGTATGAATGTTGTGAGTTGTGGTGCAGATGGCTTTACGAGAGTTTTCAGTACTCAC
ACAGGGTTGTGCAGATGCACACTCAATTCAGACACAACAAGTGTTCCTGCATTTGTTAAG
TTTGCAGACAATAATTAGTTTTTACTTGTGGATACATTAGCAAATAAAATTTAGCTTTGG
GATTGGCACCAATAAGAACTGAGATAAGTTTATACTGGAATACAAAATGATAAAGCTTAC
TTAGAGAGCTTCATGATAAGAGATAAGTACAGTAACAAGTAAAGATTTATTCTAGGATTT
TCTGAGAATAATTAAATCATAGTCTGGGATCTCCTAACTGGAAAAATACTTAAAAATTAA
AAAATTAAATCAGATACCTCATTAAAATTATATTAAAAAGACGGTTTATAGTCAAATGGA
TTTTATTTATATGGAAACGATACCCACGAAATGTTCTAATATTCTATTGATATATCACTT
ACCGACTGA


>TTHERM_00433690(protein)
MMEEEFKNYKITIQEQNLVTSMISQFDQKLIKIQQNDQNTIACCFTDGKVEIFGKENCEN
FDLKPDVTDAVTDLLWFDQNHLLCSQDKVIHIFDIEKKQSIVELQGHSQTIFCVCKNFYN
NLIASAGQDNTIMMWDIRQKKPINLILAHSRSITSLQFSKDSMNVVSCGADGFTRVFSTH
TGLCRCTLNSDTTSVPAFVKFADNNQFLLVDTLANKIQLWDWHQQELRQVYTGIQNDKAY
LESFMIRDKYSNKQRFILGFSENNQIIVWDLLTGKILKNQKIKSDTSLKLYQKDGLQSNG
FYLYGNDTHEMFQYSIDISLTD


>TTHERM_00433690(gene)
ATGATGGAGGAAGAATTTAAAAACTATAAAATAACTATTTAAGAATAAAACTTAGTGACA
AGCATGATATCATAGTTTGATTAAAAATTGATTAAAATATAATAGAATGATTAGAATACT
ATAGCTTGTTGCTTTACTGATGGTAAAGTGGAGATATTTGGCAAAGAAAACTGTGAAAAT
TTCGATCTTAAACCAGATGTAACAGATGCCGTTACTGATTTGTTATGGTTCGATTAAAAT
CACCTTCTTTGTAGTCAAGATAAAGTTATTCATATTTTTGATATAGAGAAGAAATAATCA
ATAGTTGAGCTTTAGGGCCATTCATAGACTATTTTTTGTGTATGCAAGAACTTCTACAAT
AATTTAATAGCATCTGCTGGTAATTATTTGATTAATTTTCAATTTTTTAATGCATATTCA
ACAAAAACATTTATTATTTCAAGTATTTTGTTTAAAAATCAACATACAAGTTAATTAGTA
TGCAAATTAGCTTATGAGTGAATTAGTTAGTTATTTAGTTTATTGGCAAAGTTGCGCGAG
AATTTAAATTTATTAACAGAAAAAATAAAATCATTAATTAGTAGATAAATTAATGATAAA
GTTTATTGTGAAAACATTTTTGAACAAAATAATAAGCCAAATGAACTGGCTTAAAGTATA
TATTTAGGCATATAAATCTTAACTCAATATGATTTATTATCAAATCTATTAAAATTATTT
ACCAATTTGGTAGCAGGATTATTTTTTCTCCCTATTCATTTAGCAATTTTGTAAATATTC
TGAATTTAAATAATTTTAAAGAAAATAAAAGAATGAAAGCTTAAGCACAAATAAATAAAT
AAATAATCAGTTTAAAATGATTTTGAAAATAGCAGTAAAAAAAAATAGATTTTATGAAAA
TAATAAATGAATTGATGGAGTTATTAATAGAATTGTAAAATAATATTTAGGATTTAATTA
ATACTTAATAGGTAATTAACTTGATAAATAAATAAAAATACAGATAGAAAGTAAATTTCC
TAGTTAGATAATTAGATAAATAAATAGACACAATATTTTAAGAAAATAATAATTTTTAAA
TATTTGTTAAATGATGAAATATTAGTGAATTAAATGCATATTAAAATTATTTTATTTTTT
AGATATTATTTTTAACTAATTTAACAAATTTTATAATAGGATAAGATAATACGATTATGA
TGTGGGATATTAGACAGAAGAAACCTATCAATTTAATTTTGGCTCACTCTCGTAGTATAA
CTTCCCTTTAATTTTCTAAAGATAGTATGAATGTTGTGAGTTGTGGTGCAGATGGCTTTA
CGAGAGTTTTCAGTACTCACACAGGGTTGTGCAGATGCACACTCAATTCAGACACAACAA
GTGTTCCTGCATTTGTTAAGTTTGCAGACAATAATTAGTTTTTACTTGTGGATACATTAG
CAAATAAAATTTAGCTTTGGGATTGGCACCAATAAGAACTGAGATAAGTTTATACTGGAA
TACAAAATGATAAAGCTTACTTAGAGAGCTTCATGATAAGAGATAAGTACAGTAACAAGT
AAAGATTTATTCTAGGATTTTCTGAGAATAATTAAATCATAGTCTGGGATCTCCTAACTG
GAAAAATACTTAAAAATTAAAAAATTAAATCAGATACCTCATTAAAATTATATTAAAAAG
ACGGTTTATAGTCAAATGGATTTTATTTATATGGAAACGATACCCACGAAATGTTCTAAT
ATTCTATTGATATATCACTTACCGACTGA