Identifiers and Description

Gene Model Identifier

TTHERM_00678190

Standard Name

WDR1 (WD40 Repeat containing protein 1)

Aliases

PreTt07583 | 102.m00103 | 3730.m00030

Description

Macronuclear WD40 repeat containing protein; possibly associated with DNA replication or cell division

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00678190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16396.19.997093137033517e-262hypothetical protein (1059 aa)
WormBaseWBGene000138620.000009999254677478949locus:wdr-5.3 WD repeat-cont
aining protein wdr-5.3 statu
s:Partially_confirmed UniPro
t:Q23256 protein_id:CAA98293
.1
DictyBaseDDB_G02768550.000019995566179747357DDB_G0276855 on chromosome: 2
position 7489987 to 7492179
OxytrichaContig18453.0.g80.00003998524687536623WD domain, G-beta repeat

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000318

Sequences

>TTHERM_00678190(coding)
ATGTCTACTTAAAATAAAAGCACTTCAATAGCATAATAAGATCAAGAGATTTGTAATATC
TAATAGGACATAGAGCAATAGGCATCTAAAGATAATTAAGAAAAATAATAGCCTAATAAT
AATTCTCATTTGAAATATTAAAGTGATCAGAAGTTTATTTCAATATCCAGAGGATAAAAA
AATGTATTTATTAATAACTTGAAAGGAATAAAAGGTCTTGAACTCAAATATTAAATACAG
GCAAAACATAATGATGATGCTTTTTGTCTTACTGTTTTAGATAATTAGTATTTAGCTATT
GGCTCAACTGATGCAACAATTACAATATACAATTTAAAAAATGATTGCAAACTTGTACGC
AAAATAAATTATTATTATGAGCCTATATTAATTTTAGAACCTTTAAGACTTTTCCATAAA
ACTCTTTTACTCAGCACAGGGTATGACTAAATTATTAACGTCTGGGATTATTTATCTGGG
AAAAAGATTACCGATTTAGAAGCTTGTGGATGTGAAATAACAAAATTATGTGACAATTTA
GATAAAAATCTTATAGTAGGATCAACTTTTGATGGAAGAATTATCTTATGGAGCTACACA
AATAAGCGTATTGTTAACGTATTAAAACTAAGATCCTAAATAAGTAATTAGTAAAGACTA
ATTATTCAAGAAGCTTATGAAGATCTTATTTAAACAGAAATGTAATAAATTGAAGGGATA
GGATAAGAAGATGATGATTTAGTTTCTGAAATGGATTTAGAATCACATGGTTCAATATAC
TCCTTACACTAGATTTAAAGGGATAGTTACCTTGTTTTGTAAAGAGGATGTATTTCAGAA
ATAAAAATAGTGGCTTCAAAAGATACCAAGACCAGTCAAAATGCTTAAGAGACAAAAAGT
AAATCTTAAGAAATACTGATAGAAGAAATAGATTAAGAAAATAATGATAACTAAATATAA
AATAAACAAAATGATTCTGCTAAAATAAATTATGAAATTTAGGTGCTCAGATAATTTTAA
GCAAATTAAGATGCTATACAGTTTAATTTAATACCTTTTGAAAACCAAAAAATTATCACA
TTAGGTACTAAGAGAGGCTTCATATTTCTTTATGATTTTGATACTGGAGAGGTTATAACA
AGTAAAAAAACTTTATCAGGAGCAGTTAATGAAATACTTACAATATAAACTATGCACGAT
TCTAAAGACCATCCATTTGTAATTTCAACAAGCCACACAGATAGATTTTTAAAAATTGAA
TCCCTGAAAACAGGGGACTCATTTAGAGTTGAAGATGATAGAATTTTTTGCTATAATGAA
TGCATGAACTCAAAAATGCAATTCTTCAAAAATAGATAAAATGAACTTTTCATCGCTGTT
ATTTGCCAAGAGCATTAAAACCCTTACTTTTCAATATTTAAAATCAACTTAGATTACTAT
GAATCTCAAAAAAATATCACTGAAAAGTTACTGAATTAATGA


>TTHERM_00678190(protein)
MSTQNKSTSIAQQDQEICNIQQDIEQQASKDNQEKQQPNNNSHLKYQSDQKFISISRGQK
NVFINNLKGIKGLELKYQIQAKHNDDAFCLTVLDNQYLAIGSTDATITIYNLKNDCKLVR
KINYYYEPILILEPLRLFHKTLLLSTGYDQIINVWDYLSGKKITDLEACGCEITKLCDNL
DKNLIVGSTFDGRIILWSYTNKRIVNVLKLRSQISNQQRLIIQEAYEDLIQTEMQQIEGI
GQEDDDLVSEMDLESHGSIYSLHQIQRDSYLVLQRGCISEIKIVASKDTKTSQNAQETKS
KSQEILIEEIDQENNDNQIQNKQNDSAKINYEIQVLRQFQANQDAIQFNLIPFENQKIIT
LGTKRGFIFLYDFDTGEVITSKKTLSGAVNEILTIQTMHDSKDHPFVISTSHTDRFLKIE
SLKTGDSFRVEDDRIFCYNECMNSKMQFFKNRQNELFIAVICQEHQNPYFSIFKINLDYY
ESQKNITEKLLNQ


>TTHERM_00678190(gene)
ATGTCTACTTAAAATAAAAGCACTTCAATAGCATAATAAGATCAAGAGATTTGTAATATC
TAATAGGACATAGAGCAATAGGCATCTAAAGATAATTAAGAAAAATAATAGCCTAATAAT
AATTCTCATTTGAAATATTAAAGTGATCAGAAGTTTATTTCAATATCCAGAGGATAAAAA
AATGTATTTATTAATAACTTGAAAGGAATAAAAGGTCTTGAACTCAAATATTAAATACAG
GCAAAACATAATGATGATGCTTTTTGTCTTACTGTTTTAGATAATTAGTATTTAGCTATT
GGCTCAACTGATGCAACAATTACAATATACAATTTAAAAAATGATTGCAAACTTGTACGC
AAAATAAATTATTATTATGAGCCTATATTAATTTTAGAACCTTTAAGACTTTTCCATAAA
ACTCTTTTACTCAGCACAGGGTATGACTAAATTATTAACGTCTGGGATTATTTATCTGGG
AAAAAGATTACCGATTTAGAAGCTTGTGGATGTGAAATAACAAAATTATGTGACAATTTA
GATAAAAATCTTATAGTAGGATCAACTTTTGATGGTATTTAATTATTACTTTAAATATTA
TAATACTAAATTCTAAATTTGTATCTATTTTAAATAAAAATCAAATTAACTATTAGGAAG
AATTATCTTATGGAGCTACACAAATAAGCGTATTGTTAACGTATTAAAACTAAGATCCTA
AATAAGTAATTAGTAAAGACTAATTATTCAAGAAGCTTATGAAGATCTTATTTAAACAGA
AATGTAATAAATTGAAGGGATAGGATAAGAAGATGATGATTTAGTTTCTGAAATGGATTT
AGAATCACATGGTTCAATATACTCCTTACACTAGATTTAAAGGGATAGTTACCTTGTTTT
GTAAAGAGGATGTATTTCAGAAATAAAAATAGTGGCTTCAAAAGATACCAAGACCAGTCA
AAATGCTTAAGAGACAAAAAGTAAATCTTAAGAAATACTGATAGAAGAAATAGATTAAGA
AAATAATGATAACTAAATATAAAATAAACAAAATGATTCTGCTAAAATAAATTATGAAAT
TTAGGTGCTCAGATAATTTTAAGCAAATTAAGATGCTATACAGTTTAATTTAATACCTTT
TGAAAACCAAAAAATTATCACATTAGGTACTAAGAGAGGCTTCATATTTCTTTATGATTT
TGATACTGGAGAGGTTATAACAAGTAAAAAAACTTTATCAGGAGCAGTTAATGAAATACT
TACAATATAAACTATGCACGATTCTAAAGACCATCCATTTGTAATTTCAACAAGCCACAC
AGATAGATTTTTAAAAATTGAATCCCTGAAAACAGGGGACTCATTTAGAGTTGAAGATGA
TAGAATTTTTTGCTATAATGAATGCATGAACTCAAAAATGCAATTCTTCAAAAATAGATA
AAATGAACTTTTCATCGCTGTTATTTGCCAAGAGCATTAAAACCCTTACTTTTCAATATT
TAAAATCAACTTAGATTACTATGAATCTCAAAAAAATATCACTGAAAAGTTACTGAATTA
ATGA