Identifiers and Description

Gene Model Identifier

TTHERM_00299879

Standard Name

WAG1 (W and G motifs)

Aliases

3691.m01119

Description

GW Repeat Protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00299879

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07607.19.997093137033517e-262hypothetical protein (1068 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29021213: Noto T, Mochizuki K (2017) Whats, hows and whys of programmed DNA elimination in Tetrahymena. Open biology 7(10):
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  3. Ref:20211138: Noto T, Kurth HM, Kataoka K, Aronica L, DeSouza LV, Siu KW, Pearlman RE, Gorovsky MA, Mochizuki K (2010) The Tetrahymena argonaute-binding protein Giw1p directs a mature argonaute-siRNA complex to the nucleus. Cell 140(5):692-703
  4. Ref:19596782: Bednenko J, Noto T, DeSouza LV, Siu KW, Pearlman RE, Mochizuki K, Gorovsky MA (2009) Two GW repeat proteins interact with Tetrahymena thermophila argonaute and promote genome rearrangement. Molecular and cellular biology 29(18):5020-30

Sequences

>TTHERM_00299879(protein)
MEVSLVNQEMEQKDDISIESGQLSCEQLDAAKDINHMIQNKQPALDDKEAEDEEPKSFVF
EEINTDRVQQILQEKQNEKPKKQSSGEKDSMHQNGNEDQPLRQLQSDMRTDDSKPLRESA
NTQVDFAKMSNCSTTWESNTKDETSITQNQSISNTSGSGWGGQSQNELVPKSDSSSNIWG
GSQNSMGAQTESKSSSSGWGSSNKDKVNNESVQSSSTGGWGAQSNDNTSSQNNEGNGGGW
GSSTNNNPSSSTAVWGSSTSGNEDNSNKNNSEGGWGNQSTDSGGWGSSNGNGSNNNNNNN
NSGGGRFNRNNNNNNGNNGGGRRFDRNNNNGESGNDNNGGQRRFNNNNNNRNFNKEGGEN
KNGNNGGGWNKNNNNRNGGERNNNGGGFQNQNRNNSFKKTNSNEGQSNNSGGWNSQSNDN
SQSTGGSGWGASSNDANQNNTTTSSSGWGSSTNENKNSSEASSGWGSSNTNTTANTNQTS
ESSGGWGSQQTENKQESQSSSGGWGNTSDQTQGGGDSWGSTSTNNNNNSNTNNNNRFRNN
GNNNQNNNNNRQGGNRAWGQNKDQQGGKQGNGSWGNSKQNNEQQANKSDSQDGWGNNSSN
NENSTTSGGWGNQESSKIENSTQSGTGGWGSSFSNNNNSSSENNGGGNNGKKWGASDNQN
QGENKRQGSWGNGNNRNNSNQNQGGERQNFRGNNNRNNNNNNSSFVNNNKQKSNSGEGGW
NNSSDNAPSVQSGGGGWGSTTEDNTTVQGGCGGGWGSSQVKEAASTQATTTSSWGGNNQD
SLNNDSKLLTKRPSKDPRLQEKKQTQVLSINDMSETEVQERIFGTKRVKKNEEGEDSILQ
AKSKIPQFIDLEKEEEGCFARFSPLIVDRDTDKEYNPTGIPLDEQIYEGSINQLISNKDT
IDQEDGDDDDLEMAIIINPQKLLESQLKKYQTYSGFFQVYKKYLVPEKQSILCEPCENTA
YNLFHDRLVYVIPDEPKRYNILCQFNTFMPYEQYRHLPLISTRNRTSQQELGFLDYETAI
ESIKNIQIQETKERRTIFPCWVESSLPNQHVELNKLAKYLLDKNMVAGYNYTNHATINLM
HVKQIFPDLEYVELPEQSENQKTSLICLNTLEASIYDSFCQKIPAYE


>TTHERM_00299879(coding)
ATGGAAGTTTCTCTAGTTAATTAAGAAATGGAACAAAAAGATGATATTTCAATTGAAAGT
GGTTAGCTAAGTTGTGAGTAATTGGATGCAGCTAAGGACATCAATCACATGATTTAGAAT
AAGTAACCTGCTTTAGACGATAAAGAAGCAGAAGATGAAGAACCTAAAAGCTTTGTTTTT
GAAGAAATAAATACAGATAGAGTGCAGCAAATTCTACAAGAAAAATAAAATGAAAAGCCT
AAAAAGCAATCATCAGGAGAGAAAGATTCTATGCATTAAAATGGAAATGAAGATCAACCT
CTTAGATAATTATAAAGTGATATGAGAACAGATGACTCTAAACCTTTGAGAGAAAGTGCT
AATACATAGGTAGATTTTGCTAAAATGAGTAATTGTTCTACTACATGGGAATCTAATACT
AAAGATGAAACTTCAATTACATAAAATTAATCGATTTCAAACACTAGCGGAAGCGGATGG
GGAGGATAATCTTAAAATGAGTTAGTTCCTAAGTCAGATTCTTCCTCTAATATATGGGGA
GGCAGTTAAAACTCTATGGGAGCTTAAACAGAAAGTAAATCATCTTCTTCAGGATGGGGT
TCTAGTAATAAAGATAAAGTTAATAATGAATCCGTTCAATCTTCTAGTACAGGAGGATGG
GGAGCACAAAGCAATGATAATACATCAAGCTAAAATAATGAAGGAAATGGAGGTGGATGG
GGATCATCTACCAATAACAATCCATCATCATCAACAGCAGTATGGGGAAGTTCTACTTCT
GGAAATGAAGATAATTCCAATAAAAATAACTCAGAAGGTGGATGGGGTAACTAATCTACT
GATAGCGGAGGATGGGGTTCTTCAAATGGCAATGGAAGTAATAATAATAATAATAATAAT
AACTCAGGCGGAGGTAGATTTAATAGAAATAATAACAATAACAATGGAAATAATGGAGGT
GGAAGAAGATTCGATAGAAATAACAATAATGGAGAATCTGGAAATGATAACAATGGAGGA
TAAAGGAGATTCAACAACAACAATAATAATAGGAACTTTAACAAAGAAGGAGGAGAGAAT
AAAAATGGAAATAACGGAGGAGGCTGGAATAAGAATAACAACAACAGAAATGGCGGAGAA
CGCAATAATAATGGTGGAGGGTTTTAAAACCAAAATAGAAATAATTCATTCAAAAAGACC
AATTCAAACGAAGGTTAAAGTAACAACTCTGGTGGTTGGAATAGCTAATCTAATGATAAC
TCTTAATCTACAGGAGGAAGTGGCTGGGGAGCTTCCTCAAACGATGCTAATTAAAATAAT
ACAACCACTTCTTCTAGTGGATGGGGATCTTCTACAAATGAAAATAAAAACAGTTCTGAA
GCTTCTTCAGGTTGGGGTTCTTCGAATACTAATACAACAGCAAATACAAACTAAACCAGT
GAATCTAGTGGAGGATGGGGATCTTAATAAACTGAAAATAAATAAGAATCTCAATCAAGT
AGTGGAGGTTGGGGAAACACTTCTGATTAAACTCAAGGAGGAGGAGATTCCTGGGGTTCA
ACATCTACAAATAATAACAATAATAGCAATACTAATAATAACAACAGATTTAGAAATAAT
GGGAACAACAACTAGAATAACAATAATAATAGATAGGGAGGAAATAGAGCATGGGGCTAA
AATAAAGATTAGTAAGGAGGAAAGCAAGGAAACGGAAGTTGGGGAAACTCAAAACAAAAT
AACGAATAATAAGCTAATAAGAGTGATTCTTAAGATGGGTGGGGTAATAATAGTTCTAAT
AATGAAAATTCTACAACATCAGGAGGATGGGGGAATTAAGAATCCTCAAAAATAGAAAAT
TCAACTTAGTCTGGAACTGGTGGATGGGGCTCATCTTTCTCTAATAATAACAACAGCTCT
AGTGAAAATAATGGAGGAGGCAACAATGGTAAAAAATGGGGAGCATCTGACAATTAGAAT
TAGGGTGAGAATAAAAGATAAGGCTCATGGGGAAATGGAAATAATAGAAACAACTCAAAT
TAAAATTAAGGAGGAGAGAGATAAAATTTTAGGGGAAATAATAATAGAAATAATAATAAT
AATAATTCTTCTTTTGTAAATAACAATAAATAAAAAAGTAACTCTGGGGAAGGTGGTTGG
AATAACTCTTCAGACAATGCACCTTCAGTTTAAAGTGGAGGAGGTGGATGGGGATCTACT
ACTGAAGATAACACTACAGTATAAGGAGGTTGTGGGGGTGGATGGGGTTCATCTTAAGTA
AAAGAAGCAGCAAGTACTTAAGCAACAACAACATCAAGCTGGGGAGGTAATAATTAAGAT
TCTTTAAATAATGATAGCAAATTACTCACTAAAAGACCCTCGAAAGACCCTAGACTGTAA
GAAAAAAAATAAACTCAAGTACTTAGTATTAATGATATGTCAGAAACAGAAGTTTAGGAG
AGAATATTTGGTACTAAAAGAGTTAAAAAAAATGAAGAAGGTGAAGATTCCATTCTTTAA
GCTAAGTCTAAAATTCCATAATTCATAGATTTAGAAAAAGAGGAAGAAGGATGCTTTGCT
AGATTTTCTCCTTTGATTGTTGATAGGGATACTGACAAGGAGTATAATCCTACAGGTATA
CCTCTCGATGAGTAGATTTACGAAGGATCAATAAATTAACTAATTTCAAATAAAGACACT
ATAGATCAAGAGGATGGAGATGATGATGATCTAGAAATGGCTATAATTATTAATCCATAA
AAATTGTTGGAAAGTCAACTTAAAAAGTATTAAACATACTCCGGATTTTTCTAAGTATAT
AAGAAATATCTTGTCCCTGAAAAGTAGTCAATTCTTTGCGAACCCTGTGAAAACACAGCT
TACAATCTATTTCATGATAGACTAGTATACGTAATACCTGATGAGCCCAAGCGCTATAAC
ATTCTATGCTAGTTTAATACATTCATGCCATATGAGTAATATAGACATTTACCATTGATA
TCAACACGTAACAGAACTTCTTAATAGGAGCTTGGATTTTTAGACTATGAAACTGCTATT
GAATCTATCAAAAATATTTAAATACAAGAAACTAAAGAGAGAAGAACTATTTTCCCTTGC
TGGGTTGAGTCTTCATTACCAAACTAGCATGTTGAGCTCAACAAGCTCGCTAAATATTTG
CTTGATAAAAATATGGTAGCAGGTTATAACTACACCAACCATGCTACAATCAATCTGATG
CATGTGAAATAAATTTTTCCTGATTTAGAATATGTCGAATTACCTGAATAGTCTGAAAAC
TAGAAAACATCTCTTATTTGCCTTAACACTCTTGAAGCAAGTATTTACGACTCTTTTTGC
CAAAAAATACCTGCCTATGAATGA


>TTHERM_00299879(gene)
ATGGAAGTTTCTCTAGTTAATTAAGAAATGGAACAAAAAGATGATATTTCAATTGAAAGT
GGTTAGCTAAGTTGTGAGTAATTGGATGCAGCTAAGGACATCAATCACATGATTTAGAAT
AAGTAACCTGCTTTAGACGATAAAGAAGCAGAAGATGAAGAACCTAAAAGCTTTGTTTTT
GAAGAAATAAATACAGATAGAGTGCAGCAAATTCTACAAGAAAAATAAAATGAAAAGCCT
AAAAAGCAATCATCAGGAGAGAAAGATTCTATGCATTAAAATGGAAATGAAGATCAACCT
CTTAGATAATTATAAAGTGATATGAGAACAGATGACTCTAAACCTTTGAGAGAAAGTGCT
AATACATAGGTAGATTTTGCTAAAATGAGTAATTGTTCTACTACATGGGAATCTAATACT
AAAGATGAAACTTCAATTACATAAAATTAATCGATTTCAAACACTAGCGGAAGCGGATGG
GGAGGATAATCTTAAAATGAGTTAGTTCCTAAGTCAGATTCTTCCTCTAATATATGGGGA
GGCAGTTAAAACTCTATGGGAGCTTAAACAGAAAGTAAATCATCTTCTTCAGGATGGGGT
TCTAGTAATAAAGATAAAGTTAATAATGAATCCGTTCAATCTTCTAGTACAGGAGGATGG
GGAGCACAAAGCAATGATAATACATCAAGCTAAAATAATGAAGGAAATGGAGGTGGATGG
GGATCATCTACCAATAACAATCCATCATCATCAACAGCAGTATGGGGAAGTTCTACTTCT
GGAAATGAAGATAATTCCAATAAAAATAACTCAGAAGGTGGATGGGGTAACTAATCTACT
GATAGCGGAGGATGGGGTTCTTCAAATGGCAATGGAAGTAATAATAATAATAATAATAAT
AACTCAGGCGGAGGTAGATTTAATAGAAATAATAACAATAACAATGGAAATAATGGAGGT
GGAAGAAGATTCGATAGAAATAACAATAATGGAGAATCTGGAAATGATAACAATGGAGGA
TAAAGGAGATTCAACAACAACAATAATAATAGGAACTTTAACAAAGAAGGAGGAGAGAAT
AAAAATGGAAATAACGGAGGAGGCTGGAATAAGAATAACAACAACAGAAATGGCGGAGAA
CGCAATAATAATGGTGGAGGGTTTTAAAACCAAAATAGAAATAATTCATTCAAAAAGACC
AATTCAAACGAAGGTTAAAGTAACAACTCTGGTGGTTGGAATAGCTAATCTAATGATAAC
TCTTAATCTACAGGAGGAAGTGGCTGGGGAGCTTCCTCAAACGATGCTAATTAAAATAAT
ACAACCACTTCTTCTAGTGGATGGGGATCTTCTACAAATGAAAATAAAAACAGTTCTGAA
GCTTCTTCAGGTTGGGGTTCTTCGAATACTAATACAACAGCAAATACAAACTAAACCAGT
GAATCTAGTGGAGGATGGGGATCTTAATAAACTGAAAATAAATAAGAATCTCAATCAAGT
AGTGGAGGTTGGGGAAACACTTCTGATTAAACTCAAGGAGGAGGAGATTCCTGGGGTTCA
ACATCTACAAATAATAACAATAATAGCAATACTAATAATAACAACAGATTTAGAAATAAT
GGGAACAACAACTAGAATAACAATAATAATAGATAGGGAGGAAATAGAGCATGGGGCTAA
AATAAAGATTAGTAAGGAGGAAAGCAAGGAAACGGAAGTTGGGGAAACTCAAAACAAAAT
AACGAATAATAAGCTAATAAGAGTGATTCTTAAGATGGGTGGGGTAATAATAGTTCTAAT
AATGAAAATTCTACAACATCAGGAGGATGGGGGAATTAAGAATCCTCAAAAATAGAAAAT
TCAACTTAGTCTGGAACTGGTGGATGGGGCTCATCTTTCTCTAATAATAACAACAGCTCT
AGTGAAAATAATGGAGGAGGCAACAATGGTAAAAAATGGGGAGCATCTGACAATTAGAAT
TAGGGTGAGAATAAAAGATAAGGCTCATGGGGAAATGGAAATAATAGAAACAACTCAAAT
TAAAATTAAGGAGGAGAGAGATAAAATTTTAGGGGAAATAATAATAGAAATAATAATAAT
AATAATTCTTCTTTTGTAAATAACAATAAATAAAAAAGTAACTCTGGGGAAGGTGGTTGG
AATAACTCTTCAGACAATGCACCTTCAGTTTAAAGTGGAGGAGGTGGATGGGGATCTACT
ACTGAAGATAACACTACAGTATAAGGAGGTTGTGGGGGTGGATGGGGTTCATCTTAAGTA
AAAGAAGCAGCAAGTACTTAAGCAACAACAACATCAAGCTGGGGAGGTAATAATTAAGAT
TCTTTAAATAATGATAGCAAATTACTCACTAAAAGACCCTCGAAAGACCCTAGACTGTAA
GAAAAAAAATAAACTCAAGTACTTAGTATTAATGATATGTCAGAAACAGAAGTTTAGGAG
AGAATATTTGGTACTAAAAGAGTTAAAAAAAATGAAGAAGGTGAAGATTCCATTCTTTAA
GCTAAGTCTAAAATTCCATAATTCATAGATTTAGAAAAAGAGGAAGAAGGATGCTTTGCT
AGATTTTCTCCTTTGATTGTTGATAGGGATACTGACAAGGAGTATAATCCTACAGGTATA
CCTCTCGATGAGTAGATTTACGAAGGATCAATAAATTAACTAATTTCAAATAAAGACACT
ATAGATCAAGAGGATGGAGATGATGATGATCTAGAAATGGCTATAATTATTAATCCATAA
AAATTGTTGGAAAGTCAACTTAAAAAGTATTAAACATACTCCGGATTTTTCTAAGTATAT
AAGAAATATCTTGTCCCTGAAAAGTAGTCAATTCTTTGCGAACCCTGTGAAAACACAGCT
TACAATGTATTATTTGATTTACTTACTTAATTATTTAATTTAATATTTTACTTAAAAGCT
ATTTCATGATAGACTAGTATACGTAATACCTGATGAGCCCAAGCGCTATAACATTCTATG
CTAGTTTAATACATTCATGCCATATGAGTAATATAGACATTTACCATTGATATCAACACG
TAACAGAACTTCTTAATAGGAGCTTGGATTTTTAGACTATGAAACTGCTATTGAATCTAT
CAAAAATGTAATTATTTAAAAACCTAATTTATTTTATAAATAATTTTTTTAATAGATTTA
AATACAAGAAACTAAAGAGAGAAGAACTATTTTCCCTTGCTGGGTTGAGTCTTCATTACC
AAACTAGCATGTTGAGCTCAACAAGCTCGCTAAATATTTGCTTGATAAAAATATGGTAGC
AGGTTATAACTACACCAACCATGCTACAATCAATCTGATGCATGTGAAATAAATTTTTCC
TGATTTAGAATATGTCGAATTACCTGAATAGTCTGAAAACTAGAAAACATCTCTTATTTG
CCTTAACACTCTTGAAGCAAGTATTTACGACTCTTTTTGCCAAAAAATACCTGCCTATGA
ATGA