Identifiers and Description

Gene Model Identifier

TTHERM_00471620

Standard Name

VWAT1 (Von Willebrand factor A Type 1)

Aliases

PreTt22570 | 56.m00274 | 3686.m00117

Description

von Willebrand factor type A domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01079 ) Hint module
  • ( PF00092 ) von Willebrand factor type A
  • ( TIGR01445 ) intein N-terminal splicing region
  • ( PF03731 ) Ku70/Ku80 N-terminal alpha/beta domain
  • ( TIGR00013 ) 4-oxalocrotonate tautomerase family enzyme

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00471620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07842.19.997093137033517e-262von Willebrand factor type A d
omain-containing protein (668
aa)
Stentor CoeruleusSteCoe_162090.00000000003775134544279098
DictyBaseDDB_G02859810.0000000400154582995175DDB_G0285981 on chromosome: 4
position 3901446 to 3903941
OxytrichaContig13179.0.g390.000009999254677478949Ubiquitin family

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000279

Sequences

>TTHERM_00471620(coding)
ATGGAATCTGAATTTGTAAAACCTATTTCTCACTAGCTCACTGTTAAGGAATCTATCAAA
GATAATAAATTAAGAATTTCCTTAATTCCTCCTGCTTCTATTAAAAGAAGGACTAACTCG
AATATTTGCTGTGTTGTTGATGTTTCTGGTTCTATGGGAACTGAAGCAAATTCAAATAGC
TCTGTGTCTTCATCTGAAAATTACTGTCTCAGTATTTTAGATATCGTTTAACATGCTCTT
AAAATGATTGTAAACACTTTAACGCCTGATGATGATTTATCTCTTGTAGTGTTTAGTTCT
ATGGCTATAGAAGTTTTTGATACACTAAGGATGGATGATGCAAACAAGATATTAGCTATT
GATAAAATCGAAAAGCTAGAAGCAAGTGGTAGTACTAATCTCTAGCATGGTATATAAGTT
GGATTAAATATTCTATCAAAAAGTAAATCCTAAAATAGAAATTAAGCCATGTATGTCTTA
ACAGACGGATAACCTGATGATAGAAATGTAATGTAATTTTTAAAGAAATACAAGAAAGAT
AACCCTTAACTTAGATGCACAATAAGCACTTTTGGCTTTGGAAGTAGCTGTGATAGTGAA
CTTCTTGATGAAATAGCTAGAGAATATAATGGAATGTATTCATTTATTCCTGATGCAACC
TTAATTGCAACAGCTTTTGCTAACGCCTTAGCAAATACACTTACTGTCTTTGCCAACTAT
GTCTAATTAAGAGTAAAATCTCTTAACTCTTTTAAGTTTAATGTCCCTCCTTAACAGCCA
ATTTCTTCAAAATCAATATCAAAATAATAGGATGTAATAATCTATGGAGGAGTAGTTAAC
ATCCAATAAAATAGAGATTATATTCTTGATATTTTAGAAATGCCTTAAGATGAAAATCTA
CCATACGCTCAAGTAGAAGTTATTTATTAAGAAAGCTTTAGAAGCGATAAGTAAAAGAAT
GAAAAAATTGAAGACAAAATAGTTATGGCAACTTTAAATTCTAGAGAATATGAATAAGAC
TTTGATAATCACATTTACAGGTATAAAGTGATAAGTGCAATCGATGAAAGTATTAAGTCT
TACAAAAAAAACTAATAGAGTAGTGATATAAAAAATAGACTAATGAATCTAATAGAAAAA
ATGGAAGAGATTCATGATTAAAATGATAGGCATTTTGATGGTATCTATAAAGATTTAGTA
AGAACAGTCAGCGAAGCTTTTAAGGATGCCAAAACATTTACTAGTTGGGGTGAGCATTAT
TTAACATCTCTGTTGAGAGCCCATTTAATTTAATAATGCAATACTTTTAAAGACCCAGGT
GTTTAACATTACGGTAAAGATACCTTCAAAGAAATAAGAGCAGTTGCTGATGAAACCTTT
GTGAAAATGCCTCCTCCTAAACCATATTCTAGAGCAAATTATTACGATTAAATTTAATAG
GCGAGCTAAACTGTCTAAGTATCTTAATAATCGAATTAAAGTTCTTCATCTTATAGTAGT
GCTTATAACATGAATGACTATCATAATTATAGCTCTGGAGGTTGCATGCATGGTGATTCA
CTAGTATAGCTTTCTGATTCATCCTTTAAAATGGTAAAAGAAGTTAAAAAAGGAGATAAA
GTTATTTGTCCTTTACTTGAAAACTAGTGTGTTGAAGTCGAATGCGTTGTATTATCTAAA
TGTGAAGACGGAACAAAAGAATTTGTATAGCTAGGTACTGATCTATGGATTACTCCAAAG
CATCCTATTAGAGTTAATGGAGAATGGAAATATCCAAAAGAGTTAGGTCAAACTGTAGTA
AAGACATCAGATTACATTTACTAGTTTGTACTTAAAACCGGTCATACTATGAATATTGGT
GGTTATGAATGTATATGTTTGGGTCATAACTTTTAAGAAAGAGTTGCTTATCATCCTTAT
CTTGGCTCTTAGGCAGTAGTTGAAGATTTAAAATAAATGAAAGGTTGGAAAGAAGGCAAA
GTCATCATTAGATCTAGAGTAAGAGATTAGATTACTAATCAAGTTAAAGCTTTTATACAG
TGA


>TTHERM_00471620(protein)
MESEFVKPISHQLTVKESIKDNKLRISLIPPASIKRRTNSNICCVVDVSGSMGTEANSNS
SVSSSENYCLSILDIVQHALKMIVNTLTPDDDLSLVVFSSMAIEVFDTLRMDDANKILAI
DKIEKLEASGSTNLQHGIQVGLNILSKSKSQNRNQAMYVLTDGQPDDRNVMQFLKKYKKD
NPQLRCTISTFGFGSSCDSELLDEIAREYNGMYSFIPDATLIATAFANALANTLTVFANY
VQLRVKSLNSFKFNVPPQQPISSKSISKQQDVIIYGGVVNIQQNRDYILDILEMPQDENL
PYAQVEVIYQESFRSDKQKNEKIEDKIVMATLNSREYEQDFDNHIYRYKVISAIDESIKS
YKKNQQSSDIKNRLMNLIEKMEEIHDQNDRHFDGIYKDLVRTVSEAFKDAKTFTSWGEHY
LTSLLRAHLIQQCNTFKDPGVQHYGKDTFKEIRAVADETFVKMPPPKPYSRANYYDQIQQ
ASQTVQVSQQSNQSSSSYSSAYNMNDYHNYSSGGCMHGDSLVQLSDSSFKMVKEVKKGDK
VICPLLENQCVEVECVVLSKCEDGTKEFVQLGTDLWITPKHPIRVNGEWKYPKELGQTVV
KTSDYIYQFVLKTGHTMNIGGYECICLGHNFQERVAYHPYLGSQAVVEDLKQMKGWKEGK
VIIRSRVRDQITNQVKAFIQ


>TTHERM_00471620(gene)
ATGGAATCTGAATTTGTAAAACCTATTTCTCACTAGCTCACTGTTAAGGAATCTATCAAA
GATAATAAATTAAGAATTTCCTTAATTCCTCCTGCTTCTATTAAAAGAAGGACTAACTCG
AATATTTGCTGTGTTGTTGATGTTTCTGGTTCTATGGGAACTGAAGCAAATTCAAATAGC
TCTGTGTCTTCATCTGAAAATTACTGTCTCAGTATTTTAGATATCGTTTAACATGCTCTT
AAAATGATTGTAAACACTTTAACGCCTGATGATGATTTATCTCTTGTAGTGTTTAGTTCT
ATGGCTATAGAAGTTTTTGATACACTAAGGATGGATGATGCAAACAAGATATTAGCTATT
GATAAAATCGAAAAGCTAGAAGCAAGTGGTAGTACTAATCTCTAGCATGGTATATAAGTT
GGATTAAATATTCTATCAAAAAGTAAATCCTAAAATAGAAATTAAGCCATGTATGTCTTA
ACAGACGGATAACCTGATGATAGAAATGTAATGTAATTTTTAAAGAAATACAAGAAAGAT
AACCCTTAACTTAGATGCACAATAAGCACTTTTGGCTTTGGAAGTAGCTGTGATAGTGAA
CTTCTTGATGAAATAGCTAGAGAATATAATGGAATGTATTCATTTATTCCTGATGCAACC
TTAATTGCAACAGCTTTTGCTAACGCCTTAGCAAATACACTTACTGTCTTTGCCAACTAT
GTCTAATTAAGAGTAAAATCTCTTAACTCTTTTAAGTTTAATGTCCCTCCTTAACAGCCA
ATTTCTTCAAAATCAATATCAAAATAATAGGATGTAATAATCTATGGAGGAGTAGTTAAC
ATCCAATAAAATAGAGATTATATTCTTGATATTTTAGAAATGCCTTAAGATGAAAATCTA
CCATACGCTCAAGTAGAAGTTATTTATTAAGAAAGCTTTAGAAGCGATAAGTAAAAGAAT
GAAAAAATTGAAGACAAAATAGTTATGGCAACTTTAAATTCTAGAGAATATGAATAAGAC
TTTGATAATCACATTTACAGGTATAAAGTGATAAGTGCAATCGATGAAAGTATTAAGTCT
TACAAAAAAAACTAATAGAGTAGTGATATAAAAAATAGACTAATGAATCTAATAGAAAAA
ATGGAAGAGATTCATGATTAAAATGATAGGCATTTTGATGGTATCTATAAAGATTTAGTA
AGAACAGTCAGCGAAGCTTTTAAGGATGCCAAAACATTTACTAGTTGGGGTGAGCATTAT
TTAACATCTCTGTTGAGAGCCCATTTAATTTAATAATGCAATACTTTTAAAGACCCAGGT
GTTTAACATTACGGTAAAGATACCTTCAAAGAAATAAGAGCAGTTGCTGATGAAACCTTT
GTGAAAATGCCTCCTCCTAAACCATATTCTAGAGCAAATTATTACGATTAAATTTAATAG
GCGAGCTAAACTGTCTAAGTATCTTAATAATCGAATTAAAGTTCTTCATCTTATAGTAGT
GCTTATAACATGAATGACTATCATAATTATAGCTCTGGAGGTTGCATGCATGGTGATTCA
CTAGTATAGCTTTCTGATTCATCCTTTAAAATGGTAAAAGAAGTTAAAAAAGGAGATAAA
GTTATTTGTCCTTTACTTGAAAACTAGTGTGTTGAAGTCGAATGCGTTGTATTATCTAAA
TGTGAAGACGGAACAAAAGAATTTGTATAGCTAGGTACTGATCTATGGATTACTCCAAAG
CATCCTATTAGAGTTAATGGAGAATGGAAATATCCAAAAGAGTTAGGTCAAACTGTAGTA
AAGACATCAGATTACATTTACTAGTTTGTACTTAAAACCGGTCATACTATGAATATTGGT
GGTTATGAATGTATATGTTTGGGTCATAACTTTTAAGAAAGAGTTGCTTATCATCCTTAT
CTTGGCTCTTAGGCAGTAGTTGAAGATTTAAAATAAATGAAAGGTTGGAAAGAAGGCAAA
GTCATCATTAGATCTAGAGTAAGAGATTAGATTACTAATCAAGTTAAAGCTTTTATACAG
TGA