Identifiers and Description

Gene Model Identifier

TTHERM_00471530

Standard Name

VRS1 (valyl-tRNA synthetase 1)

Aliases

PreTt22563 | 56.m00267 | 3686.m00110

Description

valyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00471530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_217730
WormBaseWBGene000069369.997093137033517e-262locus:vars-2 Valine--tRNA li
gase status:Confirmed UniP
rot:Q9U1Q4 protein_id:CAB604
28.1
Tetrahymena borealisEI9_11287.19.997093137033517e-262valyl-tRNA synthetase (1037 aa
)
DictyBaseDDB_G02777339.997093137033517e-262valS1 on chromosome: 2 positio
n 8402743 to 8406060
OxytrichaContig2447.0.g219.997093137033517e-262tRNA synthetases class I (I, L
, M and V)
SGDYGR094W9.997093137033517e-262VAS1 Mitochondrial and cytopla
smic valyl-tRNA synthetase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00471530(coding)
ATGGATATTTTTGCACAAGAAGATATGAATAGATTAACACTTTTCAAATACTTTAGCACT
TACAATAAAGCCTACTAAGCATATTAAGCTTAGCCTGCAGCTAATAAGAAAGTAGCTAGT
TATCTTGTTTAGGATAAATCAAAACCTTAAGTTGAAGAAACTGACGTCGAACTAGATGAA
GCTATTAAATAAAAAAGAAACTACGAGGCTATGCTTAAAGCTTATGAGCCTAAGTCCGTA
GAATAACATTGGATGAGATTTTGGGAGTCTAAAAAATACTTCCATGCTAATCCTTAAAAT
GTATTGAATGGATCAAAAAAACCTTACGTTATGGTTATCCCTCCTCCTAATGTTACTGGT
TATTTACATATTGGTCATGGTTTGACTACTGCTGTTGAAGATTCTATCATCAGAAGAAAG
AGAATGTTAGGTTTTGAAACTTTATACTTACCTGGTGTTGATCATGCAGGTATTGCCACA
CATTCAGTAGTTGAAAAGAAACTCTTAAAAGAAGAAAATAAGACTAGATTCTAAATTGGT
CGTGAAGCTTTCGTTTCAAAGGTTTGGGAATGGAAGGAAAAGCATGGTAACTAAATTACA
AAGTAATTAAGAAGAGTAGGTGGTAGTTTAGATTGGGATAGATTCCACTTCACCATGGAT
GATCAACTTAGTTTAGCAGTTAAGGAAGCTTTTTGCATCTTATTTGAAAAGGGTTTAATC
TACAGAAGTAACAGATTAGTTAACTGGAGTTGTGCTCTTAAAACAGCTATCAGTGATGTT
GAAGTCAATCATGAAAGAATTGAAGAACCCATTACCAGAACCATTACTGGCCATGATGGA
AAATACGAATTTGGTGTTCTCATTCACTTCTCATATAAGTTAAAAGAAGATCCTTCTAAG
GAAATCATCGTTGCTACCACCCGTATTGAAACAATGTTGGGTGATGTTGCTGTTGCTGTC
CATCCCAAGGATCCTAGATACAAAGATATCATTGGAAAGGAGCTCATCCATCCTTTCATC
CCTGACAGAAAGATGATTGTCATTGCTGATGAAGAATTGGTTGATATGAATTTCGGTACA
GGTGCTGTCAAGATTACTCCTGCTCATGATCCTAACGATTACAGATGTGGTTTACGTCAC
AATTTACCTTAAATTAACATTTTAGACGATAATGGTTTGATTAACGAAAATGGTGGACCC
TACAAAGGATTAAAGAGATTCGACTGCAGAAATAAAATTATTGAAGATTTGAAGACTATC
GGATCTTTCAAGGATAAGACCAAGAATCCTATGTCTATCGGTTTTTGCTCTCGTTCCGGA
GATGTTATCGAACCTATGCTTAGACCTCAATGGTACATAAGCTGCACTGAAATTTCAAAG
GAAATGTGCCGTATTGTTGAATAAGGAGAATTAAAAATACATCCTCAAGGTGAATTCGAA
AGTAATTGGTTCTAATTTATGAGAAATCCTCAAGATTGGTGTATTTCTCGTTAACTCTGG
TGGGGTCACAGAATTCCTGCTTATTAATACAGAGTGAAAGGAACTTCTACATCTAGCGAT
GGTACTGTTACTACTAACTGGGTAGTAGGAAGAACTGAGGATGAAGCTTTAGAACGTGCT
GCTAAAAATTTAGGAGTTAGTAAAGATTAAATTGAGTTAATTTAAGATGAAGATGTACTT
GATACTTGGTTCTCAAGTGCTCTTTTCCCTTTCTCTACTATGGGATGGCCTAATTAAACT
GATGATTTGTAAGCATTTTATCCTAACTCTATCCTTGAAACAGGTTGGGACATTCTTTTC
TTCTGGGTAGCTCGTATGGTTATGATGGGTCTCCTATTACTTAATAAGCTTCCTTTCAAG
GATGTCTTCCTTCATCCTATGATTAGAGACTCTCAAGGTGAAAAGATGTCTAAATCAAAG
GGTAATGTCATTGACCCTCTAGAAATTATTGATGGTTGCAATCTTCAAACTTTGATTCAA
AAGATTTAGGAAGGCAATTTGGACAAGAAAGAAATGAACAGAGCTGTCTAACTAAAGTCA
AAGGAATACCCTGAAGGTTTCCCTGAATGTGGAAGTGATGCATTACGTTATGGTTTATTG
GCATACATGCAACAACCTAGATCCATCAATCTTGATATCAAATAAATTATTGGATATAGA
GAATTCTGCAACAAGATTTGGTAGAGTGCCAAGTTTGGTCTTATGTATATTCCCAGAGAC
TTCAAGTATAATAGATCATTCGAATATGATTAACTCCTCTTCATCAATAAGTGGATTCTT
TCAAGATTTAACAAAGCTGTTAAAGACGTTAACCAATATTTTGATAATTATGACTTTGGT
AATGTTACTATTGCCTTCTAGAATTTCTGGAGAGACAATCTTTGTGATATCTATCTTGAA
GCCATTAAGCCTATTATTTATGGAACAGATGAAGCTTAAAAGAACCAAACTATCAATACT
TTATTCTTCGTTCTTGAATCTGGTTTAAGATTACTCCATCCCATGATGCCTTTCTTGAGT
GAAGAACTTTATCAAAAGTTCCCTGCTTTCCAAGAAAAAGGTGAATCTATTTGCATCAAC
GCCTATCCAGTTGAAAATCCTACCTTCGACAATCAATCTCTTGAAGCTGACTTCAACATT
ATTAATTCTATTGCTAAAACAATTCGTTCTCTTATTGCTAACGTTAATCTTCCTAAAAAT
GTTAGTCCTTAATGTTATGCTGTTTTACTTGGAGATAACACTGCTCACCTTTCTAATTTA
ATTACTTCATAAGCTAAGCTTATCAGCACTCTTGCAAAAACCTCATCTATTGAAATTAAG
TAAAACGAAGCTAGCGTTCCTGCTGGTTGCATTCCAAATGCAGTTGGAGGTCATCTTATT
GCATACGTTAATGTGAAAGAATATATCGATGTTATCACTGAAATAACAAGATAAGATAAG
AAGTTAGCTGAAGCTTAAAAGTCTCTTGATGATGCTATTAAGAAAACCAAAATTCCTAAC
TATGAAACAAAAGTTCCTGAAAATATTAAGCAGGCAAACAAAGAAAAAATCGATACCATT
ACTTAGAACGTTAAACTTTTACAAGATATTATTAAAATTTTAAAGAGCTTTTGA


>TTHERM_00471530(protein)
MDIFAQEDMNRLTLFKYFSTYNKAYQAYQAQPAANKKVASYLVQDKSKPQVEETDVELDE
AIKQKRNYEAMLKAYEPKSVEQHWMRFWESKKYFHANPQNVLNGSKKPYVMVIPPPNVTG
YLHIGHGLTTAVEDSIIRRKRMLGFETLYLPGVDHAGIATHSVVEKKLLKEENKTRFQIG
REAFVSKVWEWKEKHGNQITKQLRRVGGSLDWDRFHFTMDDQLSLAVKEAFCILFEKGLI
YRSNRLVNWSCALKTAISDVEVNHERIEEPITRTITGHDGKYEFGVLIHFSYKLKEDPSK
EIIVATTRIETMLGDVAVAVHPKDPRYKDIIGKELIHPFIPDRKMIVIADEELVDMNFGT
GAVKITPAHDPNDYRCGLRHNLPQINILDDNGLINENGGPYKGLKRFDCRNKIIEDLKTI
GSFKDKTKNPMSIGFCSRSGDVIEPMLRPQWYISCTEISKEMCRIVEQGELKIHPQGEFE
SNWFQFMRNPQDWCISRQLWWGHRIPAYQYRVKGTSTSSDGTVTTNWVVGRTEDEALERA
AKNLGVSKDQIELIQDEDVLDTWFSSALFPFSTMGWPNQTDDLQAFYPNSILETGWDILF
FWVARMVMMGLLLLNKLPFKDVFLHPMIRDSQGEKMSKSKGNVIDPLEIIDGCNLQTLIQ
KIQEGNLDKKEMNRAVQLKSKEYPEGFPECGSDALRYGLLAYMQQPRSINLDIKQIIGYR
EFCNKIWQSAKFGLMYIPRDFKYNRSFEYDQLLFINKWILSRFNKAVKDVNQYFDNYDFG
NVTIAFQNFWRDNLCDIYLEAIKPIIYGTDEAQKNQTINTLFFVLESGLRLLHPMMPFLS
EELYQKFPAFQEKGESICINAYPVENPTFDNQSLEADFNIINSIAKTIRSLIANVNLPKN
VSPQCYAVLLGDNTAHLSNLITSQAKLISTLAKTSSIEIKQNEASVPAGCIPNAVGGHLI
AYVNVKEYIDVITEITRQDKKLAEAQKSLDDAIKKTKIPNYETKVPENIKQANKEKIDTI
TQNVKLLQDIIKILKSF


>TTHERM_00471530(gene)
ATGGATATTTTTGCACAAGAAGATATGAATAGATTAACACTTTTCAAATACTTTAGCACT
TACAATAAAGTAAAAAAATAATTACTTTTTCCTGTTCTTTTCCATTTAAATTCAAATCAT
TTACTGATTAAATTAGCTATTGATTAAGATATGGAAATTATTTGAATTTTGTCATTTTTA
TTACTTGTTTACTCAAATAACTCATAAAATTTTTATTCTGATATGCGGCAACATGAAATT
ATTATAAATTTTGTTTTAGAATATTCTGAAATTTAAATATTTAAAATAATAAAGGCCTAC
TAAGCATATTAAGCTTAGCCTGCAGCTAATAAGAAAGTAGCTAGTTATCTTGTTTAGGAT
AAATCAAAACCTTAAGTTGAAGAAACTGACGTCGAACTAGATGAAGCTATTAAATAAAAA
AGAAACTACGAGGCTATGCTTAAAGCTTATGAGCCTAAGTCCGTAGAATAACATTGGATG
AGATTTTGGGAGTCTAAAAAATACTTCCATGCTAATCCTTAAAATGTATTGAATGGATCA
AAAAAACCTTACGTTATGGTTATCCCTCCTCCTAATGTTACTGGTTATTTACATATTGGT
CATGGTTTGACTACTGCTGTTGAAGATTCTATCATCAGAAGGTATATTATTTATTTTTCT
CAAATGTTTTTTGGTTATTAAGTTATATTTATTATTTAATAATCAGAAAGAGAATGTTAG
GTTTTGAAACTTTATACTTACCTGGTGTTGATCATGCAGGTATTGCCACACATTCAGTAG
TTGAAAAGAAACTCTTAAAAGAAGAAAATAAGACTAGATTCTAAATTGGTCGTGAAGCTT
TCGTTTCAAAGGTTTGGGAATGGAAGGAAAAGTAATTTATTTTGAAATACAAAATTCTAT
TTAAATTTATCAAAGAATGAGATAGGATAAATCAAATAAGAGAATTAATTTAATAAAAAC
ATTCTTTATTTATTTTTATATTAAAGCTGTTTTAAATTTTTTAATGATTTTTTTTAAACT
TATTTTTATGGAAATTAAGGCATGGTAACTAAATTACAAAGTAATTAAGAAGAGTAGGTG
GTAGTTTAGATTGGGATAGATTCCACTTCACCATGGATGATCAACTTAGTTTAGCAGTTA
AGGAAGCTTTTTGCATCTTATTTGAAAAGGGTTTAATCTACAGAAGTAACAGATTAGTTA
ACTGGAGTTGTGCTCTTAAAACAGCTATCAGTGATGTTGAAGTCAATCATGAAAGAATTG
AAGAACCCATTACCAGAACCATTACTGGCCATGATGGAAAATACGAATTTGGTGTTCTCA
TTCACTTCTCATATAAGTTAAAAGAAGATCCTTCTAAGGAAATCATCGTTGCTACCACCC
GTATTGAAACAATGTTGGGTGATGTTGCTGTTGGTATTAATTTATATTAGATAAATGCAA
TCTTTTTATGATAATCATATTTCTAAAAGTTATATTTTATTAACGGCTTTATTTAAAAAT
AACATTTAGCTGTCCATCCCAAGGATCCTAGATACAAAGATATCATTGGAAAGGAGCTCA
TCCATCCTTTCATCCCTGACAGAAAGATGATTGTCATTGCTGATGAAGAATTGGTTGATA
TGAATTTCGGTACAGGTGCTGTCAAGATTACTCCTGCTCATGATCCTAACGATTACAGAT
GTGGTTTACGTCACAATTTACCTTAAGTAATTACTCTATCAAATAGATTAAAATATAAAA
GCTTTTTATTAAAAGATTAACATTTTAGACGATAATGGTTTGATTAACGAAAATGGTGGA
CCCTACAAAGGATTAAAGAGATTCGACTGCAGAAATAAAATTATTGAAGATTTGAAGACT
ATCGGATCTTTCAAGGATAAGACCAAGAATCCTATGTCTATCGGTTTTTGCTCTCGTTCC
GGAGATGTTATCGAACCTATGCTTAGACCTCAATGGTACATAAGCTGCACTGAAATTTCA
AAGGAAATGTGCCGTATTGTTGAATAAGGAGAATTAAAAATACATCCTCAAGGTGAATTC
GAAAGTAATTGGTTCTAATTTATGAGAAATCCTCAAGATTGGTGTATTTCTCGTTAACTC
TGGTGGGGTCACAGAATTCCTGCTTATTAATACAGAGTAATATAATATTTAATTTAAAAT
ACAATAATAACAATAAATAAAATTTTAGGTGAAAGGAACTTCTACATCTAGCGATGGTAC
TGTTACTACTAACTGGGTAGTAGGAAGAACTGAGGATGAAGCTTTAGAACGTGCTGCTAA
AAATTTAGGAGTTAGTAAAGATTAAATTGAGTTAATTTAAGATGAAGATGTACTTGATAC
TTGGTTCTCAAGTGCTCTTTTCCCTTTCTCTACTATGGGATGGCCTAATTAAACTGATGA
TTTGTAAGCATTTTATCCTAACTCTATCCTTGAAACAGGTTGGGACATTCTTTTCTTCTG
GGTAGCTCGTATGGTTATGATGGGTCTCCTATTACTTAATAAGCTTCCTTTCAAGGATGT
CTTCCTTCATCCTATGATTAGAGACTCTCAAGGTGAAAAGATGTCTAAATCAAAGGGTAA
TGTCATTGACCCTCTAGAAATTATTGATGGTTGCAATCTTCAAACTTTGATTCAAAAGAT
TTAGGAAGGCAATTTGGACAAGAAAGAAATGAACAGAGCTGTCTAACTAAAGTCAAAGGA
ATACCCTGAAGGTTTCCCTGAATGTGGAAGTGATGCATTACGTTATGGTTTATTGGCATA
CATGCAACAACCTAGATCCATCAATCTTGATATCAAATAAATTATTGGATATAGAGAATT
CTGCAACAAGGTAAAATAAATAAATAATTAAATTAATACGATTGATAGAATGATTGCTTT
AATCCGTTTTTTATATTTTCGTAGATTTGGTAGAGTGCCAAGTTTGGTCTTATGTATATT
CCCAGAGACTTCAAGTATAATAGATCATTCGAATATGATTAACTCCTCTTCATCAATAAG
TGGATTCTTTCAAGATTTAACAAAGCTGTTAAAGACGTTAACCAATATTTTGATAATTAT
GACTTTGGTAATGTTACTATTGCCTTCTAGAATTTCTGGAGAGACAATCTTTGTGATATC
TATCTTGAAGCCATTAAGCCTATTATTTATGGAACAGATGAAGCTTAAAAGAACCAAACT
ATCAATACTTTATTCTTCGTTCTTGAATCTGGTTTAAGATTACTCCATCCCATGATGCCT
TTCTTGAGTGAAGAACTTTATCAAAAGTTCCCTGCTTTCCAAGAAAAAGGTGAATCTATT
TGCATCAACGCCTATCCAGTTGAAAATCCTACCTTCGACAATCAATCTCTTGAAGCTGAC
TTCAACATTATTAATTCTATTGCTAAAACAATTCGTTCTCTTATTGCTAACGTTAATCTT
CCTAAAAATGTTAGTCCTTAATGTTATGCTGTTTTACTTGGAGATAACACTGCTCACCTT
TCTAATTTAATTACTTCATAAGCTAAGCTTATCAGCACTCTTGCAAAAACCTCATCTGTA
AAAATATTTTTTTAAAAAAAGATTTTCTTAAAATGTATTTAAACTTATTAATATAGATTG
AAATTAAGTAAAACGAAGCTAGCGTTCCTGCTGGTTGCATTCCAAATGCAGTTGGAGGTC
ATCTTATTGCATACGTTAATGTGAAAGAATATATCGATGTTATCACTGAAGTAAATTTTG
GATTAAATTAATGTTTTAACTGTAAATTTAAAAAAATATAAAATAGATAACAAGATAAGA
TAAGAAGTTAGCTGAAGCTTAAAAGTCTCTTGATGATGCTATTAAGAAAACCAAAATTCC
TAACTATGAAACAAAAGTTCCTGAAAATATTAAGCAGGCAAACAAAGAAAAAATCGATAC
CATTACTTAGAACGTTAAACTTTTACAAGATATTATTAAAATTTTAAAGAGCTTTTGA