Identifiers and Description

Gene Model Identifier

TTHERM_01128570

Standard Name

VPSK4 (Vacuolar protein sorting-associated protein K4)

Aliases

PreTt30036 | 247.m00032 | 3817.m00178

Description

ATPase, AAA family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.1%

TetraMine Data

TTHERM_01128570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20788.19.997093137033517e-262ATPase, AAA family protein (47
4 aa)
OxytrichaContig1010.1.g861.0004025422005049e-134ATPase family associated with
various cellular activities (A
AA)
DictyBaseDDB_G02843474.0017545581927916e-85vps4 on chromosome: 4 position
1865073 to 1866634
SGDYPR173C3.999413844471248e-84VPS4 AAA-ATPase involved in mu
ltivesicular body (MVB) protei
n sorting, ATP-bound Vps4p loc
alizes to endosomes and cataly
zes ESCRT-III disassembly and
membrane release; ATPase activ
ity is activated by Vta1p; reg
ulates cellular sterol metabol
ism
WormBaseWBGene000213347.998842802738429e-74locus:vps-4 status:Confirmed
UniProt:Q9BL83 protein_id
:CCD68056.1
Stentor CoeruleusSteCoe_255066.639677199580735e-36

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01128570(coding)
ATGTTTGGATAAAATTAGAAAAAATGCGCTCATGGCCAAGGAATTATTGTTTTTGCTAAT
CCTTGCTTAAATGGACTGAATAAGTTAATTTATAATAGAAAGATTAAATAAGATCTTTAG
TAGATATTTTGCACTAAAATGTCAGGCCTTTAATCTCTTTTATGCTAAGAAAAAGACAAT
TGCATTGATAGACTATTAATTGATAACTCCAATAATAATTTAAATAATTTAGATTCTTAT
AGCAATGGCTCTATAAAAACTTAAAAATCATCCGTTTCAACTAAATCATAGAATTCTTAA
GCTTCCTCAAATAGCTTATTAGCTGTTGAAGATTTGCAGTAAAAGTATTTAAAAGATCTA
AAATCTTAGTTAAAGAGTTGTATTCTAACAAAAAAGCCGCCTATAAAATTTAAGGATATA
GCAGGAAATGATTATGCTAAAAAATGTATTGAAGAAAATTTTATACTACCCAGTGTTCTT
CCTAATCTCTTTTAAGGGAAGCCAAAACCATTTAATAAAATTTTGCTATATGGACCACCT
GGGGTGGGAAAAACAATGATATGTCATGCAGTGTGCAATGAATTGTAAGCAACTCCTTTT
TGGGTTTCATTAGCAGATATAACATCTAAATTTATAGGAGAATCAGAAAAATTGCTGAAA
ATGCTTTTTGATTTAGCTAGAGAAAATTCTCCCTCAATTATTATTTTTGATGAAATGGAT
TCAATAGGAAGAAAAAGAAATGGAAGTGAGAGTGAAACAGAAAGAAGAATTAAAACTGAA
TTCTTAAAATAATTAGATGAAATAAATAGTTTAGATGAAAAAGTTTATATTTTAGCAACT
ACAAATATGCCATGGGAATTGGATGTAGCTGTACTAAGAAGGTTTGAAAGAAGAGTACTT
CTGCCGTTACCAAAAAAGCAAGCTAGATTGGAAATTTTTTAAAACTTTACAGAATCAAAG
AATCATGGTTTAAAATAGCAAGATTTTGATTATTTATCAGATCTTACAGATGGGTACAGT
GGATCAGATATCGTAACAATAATAAATGATGCTTTTATGAGACCCATATAAGAATTATAG
ACAACTAAGTACTTTAAAAAATTAAAAGGAAACTTACTTGAAAATTTTATAGAATACTAA
GATTCATAAGTTGAAAGAATTTATTATACACCTTGTCTTCAATCAGATGAAGATGCAGAG
GAAATAAATTTATACTAACTGGATCCAAAGCAAATAATTCTAAGAAAAGCAGAGATAAAA
GATTTTAAGGAGAGCATTAAAAACTGTAAGCCAACAGTAAGTAAAAAATTCCTAGATTAC
TATAATAAATTTCTTGAGAAATGTGGTCATGTTGAATAAAAAGATGATATGTATAAGGAT
TAATTGAGATACATGACTTAAATATACTTTTGA


>TTHERM_01128570(protein)
MFGQNQKKCAHGQGIIVFANPCLNGLNKLIYNRKIKQDLQQIFCTKMSGLQSLLCQEKDN
CIDRLLIDNSNNNLNNLDSYSNGSIKTQKSSVSTKSQNSQASSNSLLAVEDLQQKYLKDL
KSQLKSCILTKKPPIKFKDIAGNDYAKKCIEENFILPSVLPNLFQGKPKPFNKILLYGPP
GVGKTMICHAVCNELQATPFWVSLADITSKFIGESEKLLKMLFDLARENSPSIIIFDEMD
SIGRKRNGSESETERRIKTEFLKQLDEINSLDEKVYILATTNMPWELDVAVLRRFERRVL
LPLPKKQARLEIFQNFTESKNHGLKQQDFDYLSDLTDGYSGSDIVTIINDAFMRPIQELQ
TTKYFKKLKGNLLENFIEYQDSQVERIYYTPCLQSDEDAEEINLYQLDPKQIILRKAEIK
DFKESIKNCKPTVSKKFLDYYNKFLEKCGHVEQKDDMYKDQLRYMTQIYF


>TTHERM_01128570(gene)
ATGTTTGGATAAAATTAGAAAAAATGCGCTCATGGCCAAGGAATTATTGTTTTTGCTAGT
AAATTAGTTTATCATTTGCATTGCTTATATTTTTACGACTTGAACAAACTTTTATCTTTA
CAAAATATTAGATCCTTGCTTAAATGGACTGAATAAGTTAATTTATAATAGAAAGATTAA
ATAAGATCTTTAGTAGATATTTTGCACTAAAATGTCAGGCCTTTAATCTCTTTTATGCTA
AGAAAAAGACAATTGCATTGATAGACTATTAATTGATAACTCCAATAATAATTTAAATAA
TTTAGATTCTTATAGCAATGGCTCTATAAAAACTTAAAAATCATCCGTTTCAACTAAATC
ATAGAATTCTTAAGCTTCCTCAAATAGCTTATTAGCTGTTGAAGATTTGCAGTAAAAGTA
TTTAAAAGATCTAAAATCTTAGTTAAAGAGTAATCTATATATTTATTTATTCTATCCTTT
TTAATAATTTTAATAATATTTTTTTTTCGCTCTCTTTTTTCTGAATTATTTTTTTCTATC
TTAATAATATCATAACTCTGTTGCAACAGTTTAATTATTTTGCTACTGAATAAAAATACT
AAAAGAAATAAACCATCATTAAATACTATGTATGTTGTTTATGGATTTAATTTTTAGCAA
TCAATCACCAATATTTGTTTATTTATCTATCAGTATTTTAATTTTCATATTGAATTTAAA
TTATTTTTTTTAAATATTAGGTTGTATTCTAACAAAAAAGCCGCCTATAAAATTTAAGGA
TATAGCAGGAAATGATTATGCTAAAAAATGTATTGAAGAAAATTTTATACTACCCAGTGT
TCTTCCTAATCTCTTTTAAGGGAAGCCAAAACCATTTAATAAAATTTTGCTATATGGACC
ACCTGGGGTGGGAAAAACAATGATATGTCATGCAGTGTGCAATGAATTGTAAGCAACTCC
TTTTTGGGTTTCATTAGCAGATATAACATCTAAATTTATAGGAGAATCAGAAAAGTAAAA
CTATTCAAACTGAAAGGAATAATTTAAAAAAATATTAAACTAAAAATTTATCAGATTGCT
GAAAATGCTTTTTGATTTAGCTAGAGAAAATTCTCCCTCAATTATTATTTTTGATGAAAT
GGATTCAATAGGAAGAAAAAGAAATGGAAGTGAGAGTGAAACAGAAAGAAGAATTAAAAC
TGAATTCTTAAAATAATTAGATGGTATTTAATTAATCTAAATTAGCATTTCAATAAAATC
TTTCTTTCATAGAAATAAATAGTTTAGATGAAAAAGTTTATATTTTAGCAACTACAAATA
TGCCATGGGAATTGGATGTAGCTGTACTAAGAAGGTTTGAAAGAAGAGTACTTCTGCCGT
TACCAAAAAAGCAAGCTAGATTGGAAATTTTTTAAAACTTTACAGGTAACAATTCTAAAA
AATAAATAAATTGAATTGTTATTTTTAAAACAGAATCAAAGAATCATGGTTTAAAATAGC
AAGATTTTGATTATTTATCAGATCTTACAGATGGGTATTTTGATTCCGTTTAATACCTAT
TATTAATTTAATAAATATAATTATAGGTACAGTGGATCAGATATCGTAACAATAATAAAT
GATGCTTTTATGAGACCCATATAAGAATTATAGACAACTAAGTACTTTAAAAAATTAAAG
TAAATTATTTATGTAAATTTAAAGAAAGTTTTAAAAATAACATCAATGTTAAAAAAGAGG
AAACTTACTTGAAAATTTTATAGAATACTAAGATTCATAAGTTGAAAGAATTTATTATAC
ACCTTGTCTTCAATCAGATGAAGATGCAGAGGAAATAAATTTATACTAACTGGATCCAAA
GCAAATAATTCTAAGAAAAGCAGAGATAGTAACTACAAGATTTATCAAGAGATTAATTTA
TTAATATTTTTATATTTTTTTAATAGAAAGATTTTAAGGAGAGCATTAAAAACTGTAAGC
CAACAGTAAGTAAAAAATTCCTAGATTACTATAATAAATTTCTTGAGAAATGTGGTCATG
TTGAATAAAAAGATGATATGTATAAGGATTAATTGAGATACATGACTTAAATATACTTTT
GA