Identifiers and Description

Gene Model Identifier

TTHERM_01128570

Standard Name

VPSK4 (Vacuolar Protein Sorting-associated protein K4)

Aliases

PreTt30036 | 247.m00032 | 3817.m00178

Description

ATPase; AAA family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.1%

TetraMine Data

TTHERM_01128570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20788.19.997093137033517e-262ATPase, AAA family protein (47
4 aa)
OxytrichaContig1010.1.g861.0004025422005049e-134ATPase family associated with
various cellular activities (A
AA)
DictyBaseDDB_G02843474.0017545581927916e-85vps4 on chromosome: 4 position
1865073 to 1866634
SGDYPR173C3.999413844471248e-84VPS4 AAA-ATPase involved in mu
ltivesicular body (MVB) protei
n sorting, ATP-bound Vps4p loc
alizes to endosomes and cataly
zes ESCRT-III disassembly and
membrane release; ATPase activ
ity is activated by Vta1p; reg
ulates cellular sterol metabol
ism
WormBaseWBGene000213347.998842802738429e-74locus:vps-4 status:Confirmed
UniProt:Q9BL83 protein_id
:CCD68056.1
Stentor CoeruleusSteCoe_255066.639677199580735e-36

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000354

Sequences

>TTHERM_01128570(coding)
ATGTTTGGATAAAATTAGAAAAAATGCGCTCATGGCCAAGGAATTATTGTTTTTGCTAAT
CCTTGCTTAAATGGACTGAATAAGTTAATTTATAATAGAAAGATTAAATAAGATCTTTAG
TAGATATTTTGCACTAAAATGTCAGGCCTTTAATCTCTTTTATGCTAAGAAAAAGACAAT
TGCATTGATAGACTATTAATTGATAACTCCAATAATAATTTAAATAATTTAGATTCTTAT
AGCAATGGCTCTATAAAAACTTAAAAATCATCCGTTTCAACTAAATCATAGAATTCTTAA
GCTTCCTCAAATAGCTTATTAGCTGTTGAAGATTTGCAGTAAAAGTATTTAAAAGATCTA
AAATCTTAGTTAAAGAGTTGTATTCTAACAAAAAAGCCGCCTATAAAATTTAAGGATATA
GCAGGAAATGATTATGCTAAAAAATGTATTGAAGAAAATTTTATACTACCCAGTGTTCTT
CCTAATCTCTTTTAAGGGAAGCCAAAACCATTTAATAAAATTTTGCTATATGGACCACCT
GGGGTGGGAAAAACAATGATATGTCATGCAGTGTGCAATGAATTGTAAGCAACTCCTTTT
TGGGTTTCATTAGCAGATATAACATCTAAATTTATAGGAGAATCAGAAAAATTGCTGAAA
ATGCTTTTTGATTTAGCTAGAGAAAATTCTCCCTCAATTATTATTTTTGATGAAATGGAT
TCAATAGGAAGAAAAAGAAATGGAAGTGAGAGTGAAACAGAAAGAAGAATTAAAACTGAA
TTCTTAAAATAATTAGATGAAATAAATAGTTTAGATGAAAAAGTTTATATTTTAGCAACT
ACAAATATGCCATGGGAATTGGATGTAGCTGTACTAAGAAGGTTTGAAAGAAGAGTACTT
CTGCCGTTACCAAAAAAGCAAGCTAGATTGGAAATTTTTTAAAACTTTACAGAATCAAAG
AATCATGGTTTAAAATAGCAAGATTTTGATTATTTATCAGATCTTACAGATGGGTACAGT
GGATCAGATATCGTAACAATAATAAATGATGCTTTTATGAGACCCATATAAGAATTATAG
ACAACTAAGTACTTTAAAAAATTAAAAGGAAACTTACTTGAAAATTTTATAGAATACTAA
GATTCATAAGTTGAAAGAATTTATTATACACCTTGTCTTCAATCAGATGAAGATGCAGAG
GAAATAAATTTATACTAACTGGATCCAAAGCAAATAATTCTAAGAAAAGCAGAGATAAAA
GATTTTAAGGAGAGCATTAAAAACTGTAAGCCAACAGTAAGTAAAAAATTCCTAGATTAC
TATAATAAATTTCTTGAGAAATGTGGTCATGTTGAATAAAAAGATGATATGTATAAGGAT
TAATTGAGATACATGACTTAAATATACTTTTGA


>TTHERM_01128570(protein)
MFGQNQKKCAHGQGIIVFANPCLNGLNKLIYNRKIKQDLQQIFCTKMSGLQSLLCQEKDN
CIDRLLIDNSNNNLNNLDSYSNGSIKTQKSSVSTKSQNSQASSNSLLAVEDLQQKYLKDL
KSQLKSCILTKKPPIKFKDIAGNDYAKKCIEENFILPSVLPNLFQGKPKPFNKILLYGPP
GVGKTMICHAVCNELQATPFWVSLADITSKFIGESEKLLKMLFDLARENSPSIIIFDEMD
SIGRKRNGSESETERRIKTEFLKQLDEINSLDEKVYILATTNMPWELDVAVLRRFERRVL
LPLPKKQARLEIFQNFTESKNHGLKQQDFDYLSDLTDGYSGSDIVTIINDAFMRPIQELQ
TTKYFKKLKGNLLENFIEYQDSQVERIYYTPCLQSDEDAEEINLYQLDPKQIILRKAEIK
DFKESIKNCKPTVSKKFLDYYNKFLEKCGHVEQKDDMYKDQLRYMTQIYF


>TTHERM_01128570(gene)
ATGTTTGGATAAAATTAGAAAAAATGCGCTCATGGCCAAGGAATTATTGTTTTTGCTAGT
AAATTAGTTTATCATTTGCATTGCTTATATTTTTACGACTTGAACAAACTTTTATCTTTA
CAAAATATTAGATCCTTGCTTAAATGGACTGAATAAGTTAATTTATAATAGAAAGATTAA
ATAAGATCTTTAGTAGATATTTTGCACTAAAATGTCAGGCCTTTAATCTCTTTTATGCTA
AGAAAAAGACAATTGCATTGATAGACTATTAATTGATAACTCCAATAATAATTTAAATAA
TTTAGATTCTTATAGCAATGGCTCTATAAAAACTTAAAAATCATCCGTTTCAACTAAATC
ATAGAATTCTTAAGCTTCCTCAAATAGCTTATTAGCTGTTGAAGATTTGCAGTAAAAGTA
TTTAAAAGATCTAAAATCTTAGTTAAAGAGTAATCTATATATTTATTTATTCTATCCTTT
TTAATAATTTTAATAATATTTTTTTTTCGCTCTCTTTTTTCTGAATTATTTTTTTCTATC
TTAATAATATCATAACTCTGTTGCAACAGTTTAATTATTTTGCTACTGAATAAAAATACT
AAAAGAAATAAACCATCATTAAATACTATGTATGTTGTTTATGGATTTAATTTTTAGCAA
TCAATCACCAATATTTGTTTATTTATCTATCAGTATTTTAATTTTCATATTGAATTTAAA
TTATTTTTTTTAAATATTAGGTTGTATTCTAACAAAAAAGCCGCCTATAAAATTTAAGGA
TATAGCAGGAAATGATTATGCTAAAAAATGTATTGAAGAAAATTTTATACTACCCAGTGT
TCTTCCTAATCTCTTTTAAGGGAAGCCAAAACCATTTAATAAAATTTTGCTATATGGACC
ACCTGGGGTGGGAAAAACAATGATATGTCATGCAGTGTGCAATGAATTGTAAGCAACTCC
TTTTTGGGTTTCATTAGCAGATATAACATCTAAATTTATAGGAGAATCAGAAAAGTAAAA
CTATTCAAACTGAAAGGAATAATTTAAAAAAATATTAAACTAAAAATTTATCAGATTGCT
GAAAATGCTTTTTGATTTAGCTAGAGAAAATTCTCCCTCAATTATTATTTTTGATGAAAT
GGATTCAATAGGAAGAAAAAGAAATGGAAGTGAGAGTGAAACAGAAAGAAGAATTAAAAC
TGAATTCTTAAAATAATTAGATGGTATTTAATTAATCTAAATTAGCATTTCAATAAAATC
TTTCTTTCATAGAAATAAATAGTTTAGATGAAAAAGTTTATATTTTAGCAACTACAAATA
TGCCATGGGAATTGGATGTAGCTGTACTAAGAAGGTTTGAAAGAAGAGTACTTCTGCCGT
TACCAAAAAAGCAAGCTAGATTGGAAATTTTTTAAAACTTTACAGGTAACAATTCTAAAA
AATAAATAAATTGAATTGTTATTTTTAAAACAGAATCAAAGAATCATGGTTTAAAATAGC
AAGATTTTGATTATTTATCAGATCTTACAGATGGGTATTTTGATTCCGTTTAATACCTAT
TATTAATTTAATAAATATAATTATAGGTACAGTGGATCAGATATCGTAACAATAATAAAT
GATGCTTTTATGAGACCCATATAAGAATTATAGACAACTAAGTACTTTAAAAAATTAAAG
TAAATTATTTATGTAAATTTAAAGAAAGTTTTAAAAATAACATCAATGTTAAAAAAGAGG
AAACTTACTTGAAAATTTTATAGAATACTAAGATTCATAAGTTGAAAGAATTTATTATAC
ACCTTGTCTTCAATCAGATGAAGATGCAGAGGAAATAAATTTATACTAACTGGATCCAAA
GCAAATAATTCTAAGAAAAGCAGAGATAGTAACTACAAGATTTATCAAGAGATTAATTTA
TTAATATTTTTATATTTTTTTAATAGAAAGATTTTAAGGAGAGCATTAAAAACTGTAAGC
CAACAGTAAGTAAAAAATTCCTAGATTACTATAATAAATTTCTTGAGAAATGTGGTCATG
TTGAATAAAAAGATGATATGTATAAGGATTAATTGAGATACATGACTTAAATATACTTTT
GA