Identifiers and Description

Gene Model Identifier

TTHERM_00989490

Standard Name

VPS42 (Vacuolar Protein Sorting 4-2)

Aliases

PreTt07839 | 185.m00060

Description

ATPase, AAA family protein; associated with membrane vesicle trafficking

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF04212 ) MIT domain
  • ( TIGR02880 ) CbbX protein
  • ( PF00004 ) ATPase, AAA family
  • ( TIGR01242 ) 26S proteasome subunit P45 family
  • ( TIGR01241 ) ATP-dependent metallopeptidase HflB
  • ( PF09336 ) Vps4 C terminal oligomerisation domain
  • ( TIGR02237 ) DNA repair and recombination protein
  • ( PF02189 ) Immunoreceptor tyrosine-based activation motif
  • ( PF07724 ) ATPase family associated with various
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_00989490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02920.19.997093137033517e-262ATPase, AAA family protein (49
3 aa)
OxytrichaContig13722.0.g1023.998176907651524e-145ATPase family associated with
various cellular activities (A
AA)
SGDYPR173C1.000157752625888e-137VPS4 AAA-ATPase involved in mu
ltivesicular body (MVB) protei
n sorting, ATP-bound Vps4p loc
alizes to endosomes and cataly
zes ESCRT-III disassembly and
membrane release; ATPase activ
ity is activated by Vta1p; reg
ulates cellular sterol metabol
ism
DictyBaseDDB_G02843471.0001366335892501e-125vps4 on chromosome: 4 position
1865073 to 1866634
WormBaseWBGene000213343.9996672065071595e-120locus:vps-4 status:Confirmed
UniProt:Q9BL83 protein_id
:CCD68056.1
Stentor CoeruleusSteCoe_154821.580420060273613e-61

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000328

Sequences

>TTHERM_00989490(coding)
ATGAGCAATAACCCTATGATGTAATTTAGAGACATCGCTCTCTAAAAAATTACTCAAGGT
ATTAACATCTTTAATACCAAGAAGGATAACATTAATGAAAGAGATTAAGGTTATAGGTTG
ATGGTTTCTGGTCTTGAAGACTTAATCAAGTATAGAAAGCAAGAAACAAATGTTGATATT
TAAAATATTTTAAAGCCAAAGATAGATGAATATTTAAAGCAAGCAGCTGCCATGAAAGCT
GAAATTTCTGCCTAATAACAGAACATTAATCAATAGATTCAAAAGCAATCTTAATTTAGC
TATCAAGCAAACAATTAAAATTTGAATAATATTAACACTAATATGAATAATAATAATAAT
CAAAATTAATATAAGCCTCCAGTTAACAACAACAACAACAACAATAATAGCAATAACACC
AATAACAATAATGGTGGAAATAACTAAAACAATAACTAAGGAAAAAGTTAAATCAAGGAA
GGTGATAAAGATAATGCTAAGTTTGAACAAGCATTAGGTGAAGCAATTGTTACTGAAAAG
CCAAATGTTCACTGGTCTGATGTTGCTGGTTTAGAAAATGCTAAGAAAGCACTTAATGAA
GCAGTTATCCTACCCATCAGATTCCCTCATATATTCTAAGGTATGATCAAGCCTTGGAGA
GGTATTTTGTTATATGGACCTCCAGGTACTGGTAAAACATTCTTGGCTAAGGCTTGTGCA
ACAGAATGTGATGCTACCTTCTTCTCTATTTCCTCCTCTGATTTAATTTCTAAGTGGGTT
GGTGAATCTGAAAAGTTAATTAAGACTTTGTTTAAAATGGCCAGAGAGAAAAAACCTTCT
ATTATATTTATTGACGAAATAGATTCAATGACTGGAAATAGATCTGAAGGTGAGAATGAA
GCATCCAGAAGAGTCAAAACTGAATTTTTAGTTTAAATGCAAGGTGTTGGCAATGATGAC
ACTGGTGTTCTTGTCCTTGGTGCTACAAACGTTCCTTGGGGTTTAGATCCTGCTATTAGA
AGAAGATTTGAAAAAAGAATTATGATTCCTTTACCAGAAAAGGAAGCTAGATTCTAATTG
ATTGACAATCTCTTGAATAAAACTCCCAACTGCATTACATAAGAAGAAAGATTATACATT
GCAGAAAGAACTGAAGGTTTTTCAGGTTCTGATATATCTATTTTAGTTAGAGAAGCTTCA
TATGAGCCTCTGAGAATAGCATAAAGAGCCACTAAATTCAAAAAGATTTAAGACAAAGAT
GGCTAACCTAAGTATGTTGCTTGTGCTCCTAGTGATCCCTAAGGTGAATCAAAAGTATTA
ATGGATATATAAGGTAGTATGTTAAAATTGTAAGATGTCAGTATAGATCACTTCGAATTA
GCCTTGTAATCTTGTAAACCCTCAGTCTCTGAAAAAGATATAGAGAGACAAATTGAATTC
ACTAAAGAATTCGGCCAAGATGGTTGA


>TTHERM_00989490(protein)
MSNNPMMQFRDIALQKITQGINIFNTKKDNINERDQGYRLMVSGLEDLIKYRKQETNVDI
QNILKPKIDEYLKQAAAMKAEISAQQQNINQQIQKQSQFSYQANNQNLNNINTNMNNNNN
QNQYKPPVNNNNNNNNSNNTNNNNGGNNQNNNQGKSQIKEGDKDNAKFEQALGEAIVTEK
PNVHWSDVAGLENAKKALNEAVILPIRFPHIFQGMIKPWRGILLYGPPGTGKTFLAKACA
TECDATFFSISSSDLISKWVGESEKLIKTLFKMAREKKPSIIFIDEIDSMTGNRSEGENE
ASRRVKTEFLVQMQGVGNDDTGVLVLGATNVPWGLDPAIRRRFEKRIMIPLPEKEARFQL
IDNLLNKTPNCITQEERLYIAERTEGFSGSDISILVREASYEPLRIAQRATKFKKIQDKD
GQPKYVACAPSDPQGESKVLMDIQGSMLKLQDVSIDHFELALQSCKPSVSEKDIERQIEF
TKEFGQDG


>TTHERM_00989490(gene)
ATGAGCAATAACCCTATGATGTAATTTAGAGACATCGCTCTCTAAAAAATTACTCAAGGT
ATTAACATCTTTAATACCAAGAAGGATAACATTAATGAAAGAGATTAAGGTTATAGGTTG
ATGGTTTCTGGTCTTGAAGACTTAATCAAGTATAGAAAGCAAGAAACAAATGTTGATATT
TAAAATATTTTAAAGCCAAAGATAGATGAATATTTAAAGCAAGCAGCTGCCATGAAAGCT
GAAATTTCTGCCTAATAACAGAACATTAATCAATAGATTCAAAAGCAATCTTAATTTAGC
TATCAAGCAAACAATTAAAATTTGAATAATATTAACACTAATATGAATAATAATAATAAT
CAAAATTAATATAAGCCTCCAGTTAACAACAACAACAACAACAATAATAGCAATAACACC
AATAACAATAATGGTGGAAATAACTAAAACAATAACTAAGGAAAAAGTTAAATCAAGTAA
AAAGTTAATTTTGTTAGGATGATTTTTTTTAATTGTTTTTTATATCGATAGGGAAGGTGA
TAAAGATAATGCTAAGTTTGAACAAGCATTAGGTGAAGCAATTGTTACTGAAAAGCCAAA
TGTTCACTGGTCTGATGTTGCTGGTTTAGAAAATGCTAAGAAAGCACTTAATGAAGCAGT
TATCCTACCCATCAGATTCCCTCATATATTCTAAGGTATGATCAAGCCTTGGAGAGGTAT
TTTGTTATATGGACCTCCAGGTACTGGTAAAACATTCTTGGCTAAGGCTTGTGCAACAGA
ATGTGATGCTACCTTCTTCTCTATTTCCTCCTCTGATTTAATTTCTAAGTGGGTTGGTGA
ATCTGAAAAGTTAATTAAGACTTTGTTTAAAATGGCCAGAGAGAAAAAACCTTCTATTAT
ATTTATTGACGAAATAGATTCAATGACTGGAAATAGGTAAAAATATTACTTATGAAAATT
GTGACAATTTCTTGATTCATTCATAGATTATTTTTTTTTTAAATGTTCATTTTTTTTATT
GACAGTTCAAATCAAATATTTGAAATATGTTGATGATTGCTTGAAAAAATATATCATTTT
TTAACTAAAAAATTGAATTTGCTTATGATTTATTGTAATAAAAAGATCTGAAGGTGAGAA
TGAAGCATCCAGAAGAGTCAAAACTGAATTTTTAGTTTAAATGCAAGGTGTTGGCAATGA
TGACACTGGTGTTCTTGTCCTTGGTGCTACAAACGTTCCTTGGGGTTTAGATCCTGCTAT
TAGAAGAAGGTAAAAACAATTATTGAAGTTAGTGAATGTGTTTTTTATTTATAAATTTTC
AAAAAATAATTAGATTTGAAAAAAGAATTATGATTCCTTTACCAGAAAAGGAAGCTAGAT
TCTAATTGATTGACAATCTCTTGAATAAAACTCCCAACTGCATTACATAAGAAGAAAGAT
TATACATTGCAGAAAGAACTGAAGGGTATTTATCCATTTTATATTATATTAATTTTTAAA
CTTGTTTATTAAAAATAGTTTTTCAGGTTCTGATATATCTATTTTAGTTAGAGAAGCTTC
ATATGAGCCTCTGAGAATAGCATAAAGAGCCACTAAATTCAAAAAGATTTAAGACAAAGA
TGGCTAACCTAAGTATGTTGCTTGTGCTCCTAGTGATCCCTAAGGTGAATCAAAAGTATT
AATGGATATATAAGGTAGTATGTTAAAATTGTAAGATGTCAGTATAGATCACTTCGAATT
AGCCTTGTAATCTTGTAAACCCTCAGTCTCTGAAAAAGATATAGAGAGACAAATTGAATT
CACTAAAGAATTCGGCCAAGATGGTTGA