Identifiers and Description

Gene Model Identifier

TTHERM_00036960

Standard Name

VPS41 (Vacuolar Protein Sorting 4-1)

Aliases

PreTt14431 | 2.m02094 | 3825.m02804

Description

VPS4-like ATPase, AAA family protein; associated with vesicle formation and programmed nuclear death; localizes to cytoplasm and oral apparatus during growth and to parental macronucleus during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00036960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00957.19.997093137033517e-262ATPase, AAA family protein (44
4 aa)
OxytrichaContig13722.0.g1023.0011260078469234e-135ATPase family associated with
various cellular activities (A
AA)
SGDYPR173C9.001601097193671e-134VPS4 AAA-ATPase involved in mu
ltivesicular body (MVB) protei
n sorting, ATP-bound Vps4p loc
alizes to endosomes and cataly
zes ESCRT-III disassembly and
membrane release; ATPase activ
ity is activated by Vta1p; reg
ulates cellular sterol metabol
ism
WormBaseWBGene000213341.9999788875029746e-125locus:vps-4 status:Confirmed
UniProt:Q9BL83 protein_id
:CCD68056.1
DictyBaseDDB_G02843479.996261361959507e-120vps4 on chromosome: 4 position
1865073 to 1866634
Stentor CoeruleusSteCoe_255061.733141042341547e-58

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000323

Sequences

>TTHERM_00036960(coding)
ATGTTTTACGGAGGTAATAACGCTCCCTCATTTAAGTTAGATAATACTTAAATTCGTAAT
GAAACATAGTACCTGATTGAGAAAGGTAGAAGATCTTTCAATGAAGGTGATACAATTGAA
GAAAAGGATAAGGGTATTTCAACCTTTTTACAAGGTTTAAAGAAGTTAGAACTATGGATA
TAAAGAGAAACTGATACTTTAATTCTAAATACTTTAAAAACCTAATACCAAAATAACTAT
AAAGAAGTAGAAACTATGCTTACAAAATTAGAATAAATTAAAAAAAATGGAAACTAGCCT
ATGGCAATAGCATAAGGCGGCGGCGGTGGTAACAACAATAGTAACAAAGATGAAAACACT
AAATTTAAGGAAGCTTTGTAAGAAACAATTGTGCCCGAAAAACCTAACATAAAATGGGAT
GATATTGCTGGTTTAGTGAAGGCTAAGGAATCCTTAAAAGAAGCAGTCATTCTTCCAATT
AGATTCCCTGAAATATTTAAAGGTGCTCGTAAGCCATGGAAAGGTATCCTTCTTTATGGA
CCTCCAGGTACTGGTAAAACTTATTTAGCTAAAGCTTGTGCTACAGAAACTGAAGGTACT
TTCTTTTCAGTATCCTCTGCAGATCTTGTCAGCAAATATGTTGGTGAATCAGAAAAATTA
ATTAAGAACTTATTTGCTTTAGCTAGAGAGAAAAAGCCTTCTATTATATTTATTGATGAA
GTAGACAGTTTATGTGGTAATAGAAGTGACGGAGAAAATGATGCTTCAAGAAGAGTAAAA
ACAGAGTTTTTGGTTTAGATGCAAGGTGTTGGTAATGATGATTAAGGTGTTTTGGTACTT
GGAGCAACCAATTTACCATGGGCTCTCGATCCTGCTATTAGAAGAAGATTTGAAAAAAGA
ATCTACATCCCCTTGCCTGACTAACCCGCCAGAAAATTCTTGCTCAAACATAACCTTAAA
AATACTCCAAACACTCTTAAAGAAGAAGATTTTGAAAGATTATCCTAATTAACAGACGGA
TTCTCAGGAGCTGATATGTCTATATTTGTAAGAGATGCAGTACTAGAACCAGTTAGAAGA
TTATAGATTGCAACTAAATTCAAAAAGTTACCAGGAGACAAATACATGCCTGTAGAAGAT
AATGCTTCAGGTCCTGATATTGTTAACCTTAACTATTTAAGCTTAAATCAGTAATAGCTT
GAGCTTCCATAAATATCTGCACAAGATTTTGAAATCGCCATTAAAAAAGCCAAAGGTACT
GTTGGAAAAGATTAGCTCAAAGATTATGAAAAGTGGACTACTGAATTTGGTCAAGATGGT
TGA


>TTHERM_00036960(protein)
MFYGGNNAPSFKLDNTQIRNETQYLIEKGRRSFNEGDTIEEKDKGISTFLQGLKKLELWI
QRETDTLILNTLKTQYQNNYKEVETMLTKLEQIKKNGNQPMAIAQGGGGGNNNSNKDENT
KFKEALQETIVPEKPNIKWDDIAGLVKAKESLKEAVILPIRFPEIFKGARKPWKGILLYG
PPGTGKTYLAKACATETEGTFFSVSSADLVSKYVGESEKLIKNLFALAREKKPSIIFIDE
VDSLCGNRSDGENDASRRVKTEFLVQMQGVGNDDQGVLVLGATNLPWALDPAIRRRFEKR
IYIPLPDQPARKFLLKHNLKNTPNTLKEEDFERLSQLTDGFSGADMSIFVRDAVLEPVRR
LQIATKFKKLPGDKYMPVEDNASGPDIVNLNYLSLNQQQLELPQISAQDFEIAIKKAKGT
VGKDQLKDYEKWTTEFGQDG


>TTHERM_00036960(gene)
ATGTTTTACGGAGGTAATAACGCTCCCTCATTTAAGTTAGATAATACTTAAATTCGTAAT
GAAACATAGTACCTGATTGAGAAAGGTAGAAGATCTTTCAATGAAGGTGATACAATTGAA
GAAAAGGATAAGGGTATTTCAACCTTTTTACAAGGTTTAAAGAAGTTAGAACTATGGATA
TAAAGTAATTTATTTAGATTTACAAATTCGAATCGTTTAAGCTTAAAAAAATAACGCGAA
TCAATTGAAAAATTAACCATTTTTTATTATAATTAACAGGAGAAACTGATACTTTAATTC
TAAATACTTTAAAAACCTAATACCAAAATAACTATAAAGAAGTAGAAACTATGCTTACAA
AATTAGAATAAATTAAAAAAAATGGAAACTAGCCTATGGCAATAGCATAAGGCGGCGGCG
GTGGTAACAAGTAAAATATATTGCAAAATTAGCTAAGTTTAAATATAAAATTTGGTTTTA
AAATAAAATGAAAGCTTATTCTTTAAATTATTTATAGTGGCATTAATTCTTTCATGTATT
ATCACTTAGATTAATTTTATTTTATCTTAAATAGCAATAGTAACAAAGATGAAAACACTA
AATTTAAGGAAGCTTTGTAAGAAACAATTGTGCCCGAAAAACCTAACATAAAATGGGATG
ATATTGCTGGTTTAGTGAAGGCTAAGGAATCCTTAAAAGAAGCAGTCATTCTTCCAATTA
GATTCCCTGAAATATTTAAAGGTGCTCGTAAGCCATGGAAAGGTATCCTTCTTTATGGAC
CTCCAGGTACTGGTAAAACTTATTTAGCTAAAGCTTGTGCTACAGAAACTGAAGGTACTT
TCTTTTCAGTATCCTCTGCAGATCTTGTCAGCAAATATGTTGGTGAATCAGAAAAGTAAT
TTAATTTAATTTAATTTACATTCATTTTCTTTCAGCAAAAAAAACATTATCAATATTTGA
TTAATTAGTGTCTTTAATTATTAAGACAAAATCAACTCTTTAAAAATTTATTAGAATTTC
ATGCTTCACTTTCAAAATATCTTTTGATTGTAATATAAATCAGTCAAAATGAATGAAAAA
ATTCATTCATTCATTCATTCTTTATTTATTATTTTTCTAAAATTTGAAAGTTCATTATTT
GCATGAAAACAAATAAGTTATTATAGATAAAATTAATTTGGTTTATTTCACAATATTTCT
GATCGCATCAATAGGAAATATTGATCAGCATTTGAATATTTATTTATTTAATAAATATCT
CATTTTTCTTTTAAGATTAGAAAATATTTTTACAGTCTATCAAGAAATATAAAAATTTTT
TGAATGCATTTTCATAGGATAAATATATTTTTAAAATAAAAAATAATAGATTAATTAAGA
ACTTATTTGCTTTAGCTAGAGAGAAAAAGCCTTCTATTATATTTATTGATGAAGTAGACA
GTTTATGTGGTAATAGAAGTGACGGAGAAAATGATGCTTCAAGAAGAGTAAAAACAGAGT
TTTTGGTTTAGATGCAAGGTGTTGGTAATGATGATTAAGGTGTTTTGGTACTTGGAGCAA
CCAATTTACCATGGGCTCTCGATCCTGCTATTAGAAGAAGATTTGAAAAAAGAATCTACA
TCCCCTTGCCTGACTAACCCGCCAGAAAATTCTTGCTCAAACATAACCTTAAAAATACTC
CAAACACTCTTAAAGAAGAAGATTTTGAAAGATTATCCTAATTAACAGACGGGTAAAATG
ATTATAAAAGAAATATACAGAATTTTAACATGTTAATTAAAAACAATATATAGATTCTCA
GGAGCTGATATGTCTATATTTGTAAGAGATGCAGTACTAGAACCAGTTAGAAGATTATAG
ATTGCAACTAAATTCAAAAAGTTACCAGGAGACAAATACATGCCTGTAGAAGATAATGCT
TCAGGTCCTGATATTGTTAACCTTAACTATTTAAGCTTAAATCAGTAATAGCTTGAGCTT
CCATAAATATCTGCAGTAAAATTTTTTATTTTTTTATTTTATATTTTTAATAAATAAATT
CTATTTAATAATAAAGCAAGATTTTGAAATCGCCATTAAAAAAGCCAAAGGTACTGTTGG
AAAAGATTAGCTCAAAGATTATGAAAAGTGGACTACTGAATTTGGTCAAGATGGTTGA