Identifiers and Description

Gene Model Identifier

TTHERM_00649380

Standard Name

VPS34 (Tetrahymena ortholog to yeast Vps34 and human PiK3c3 )

Aliases

PreTt09252 | 94.m00170 | 3677.m00078 | TtVPS34

Description

A class III phosphatidylinositol 3-kinase involved in the nuclear degradation events of Programmed nuclear death (PND)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • obsolete inositol or phosphatidylinositol kinase activity (IEA) | GO:0004428
  • phosphotransferase activity, alcohol group as acceptor (IEA) | GO:0016773
  • 1-phosphatidylinositol-3-kinase activity (IEA) | GO:0016303

Biological Process

Domains

  • ( PF00792 ) Phosphoinositide 3-kinase C2 domain
  • ( PF00454 ) Phosphatidylinositol 3- and 4-kinase
  • ( PF00613 ) Phosphoinositide 3-kinase family, accessory domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00649380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17891.19.997093137033517e-262phosphatidylinositol 3- and 4-
kinase (906 aa)
OxytrichaContig7655.0.g671.9995317320402142e-140Phosphatidylinositol 3- and 4-
kinase
DictyBaseDDB_G02896016.001115222296727e-111pikE on chromosome: 5 position
3005109 to 3008075
SGDYLR240W2.0006821221283624e-88VPS34 Phosphatidylinositol 3-k
inase responsible for the synt
hesis of phosphatidylinositol
3-phosphate; forms membrane-as
sociated signal transduction c
omplex with Vps15p to regulate
protein sorting; activated by
the GTP-bound form of Gpa1p
WormBaseWBGene000069322.999277470785175e-69locus:vps-34 Phosphatidylino
sitol 3-kinase status:Confir
med UniProt:Q9TXI6 protein
_id:CCD61195.1
Stentor CoeruleusSteCoe_278935.166420632837861e-55

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:24280724: Akematsu T, Fukuda Y, Attiq R, Pearlman RE (2014) Role of class III phosphatidylinositol 3-kinase during programmed nuclear death of Tetrahymena thermophila. Autophagy 10(2):209-25

Sequences

>TTHERM_00649380(coding)
ATGAAAAAAGGACCAACAGAATATATTCAACATACTCTTTTAGATTAACTTCCAGTAAAG
TTTAAAATATGCTGCATTAATGATTAAAAAAAAGTCTTGAGATACTTTTTTAATGACGAA
GATGGTAGCAGTAAATTAGAAAATTTGGAAGCAATGGTAACAGCTTAATTAGTTGTAAAT
GAAAAAAAAATATAGCCAGCATAGCAAACACTATTTATTGATAGGATGCTTTTTGAATAG
AATATTATTTTTAATTATAAGTACAAAGATTTGAGTTATAATTCTATTATTGCAATTACA
TTATGGTGTTCCCAAAAAAATAAAGATGAAAAAAAACCTTTGGGATGCACAACTATAAGT
CTTTTTGATGATTAATTTCGTTTGAGATAAGGGAAATATCATTTATATATATGGCCAGAT
ACTCTACCTGATACTTCTTATACTTCTATAACTCCTGGATTAGTGACTGATGATAATATC
AAGTAGATCAATTTCTCACATTAAAAAACAGAATAGGCCTTTACAAATGTAAATAAATTT
CCATAAAAGACTGGCTCATCTATCCATAGAAACTAACTTAAAGAATAGCTTGATCTTTAA
AAAATTTATGCTTTTCAAAAGATCCCTAGTGCCTTCCTTGAAATAGATTTTCCAAATTTT
GAAACATTGGTGCTTTACCAAGAGCCAGAATACATAATTGATAATGATTTAAGTTCTAAA
GAAATAAACAATTCTTAATCTAATTCATCAACAAATTCCAATCAATAATCACTTACTGGT
GGTAAATCTTCTAAGTTTTTTATATAAGAAGTAGATTTTTCAGAATGCGTAGTTACATCT
GATTTTGATTATGAGAATCGTAAAGATGATTTAATTTAAGAGCAAACTGCCCTTATTATT
AGAGAAGATGAAAATCCTTAATAGCTAAAACCATCTAAAAATGAATTACAAATTATAGAA
AATTCAATAAAAAAACCCATTTTAGGCGAATTGAAGCAAGATGAGAAGCTCTTATTTTAT
AGATTTAGATACTCTTTGGTTTAGAATCCTGAGGCCTTAGTAAAGTTTTTGCACTCAATT
AATTGGGATAACTAAAAAGAATTAAATGAAGCTAAGAAATTATTGAAAATTTGGGCAAAA
TGCTCATACGGAGATGCTTTGCACTTACTTTCAAGCTCATTTTGTGCAAACGAGTTCTAT
AATAAAAAATATAAAAAGCCATAAGATACTGCAATATATATACGTAAATATGCTTGTGAA
TAACTGGAAAAAGAATAAACATCAACAATTTGTTCAATTCTATTGTAGCTTACACAAGCT
TTAAGATATGAACCTTTTGATTATTAAAAAAGTCATCTTGCTTAATTTTTAGTAAAAAAG
GCATGCGAAAACACAGAAATAGCTACACTGTTTTATTGGTATCTTTTAGTCGAATGTGAT
AAAGAAATGGACTTAAAAGAAAAAGCAAAACTTAGTTCTACTAACTAAAAAGTGTAGGAA
TGGTTTAATTAAGTATTTGAAAGGATGAATGAAGAATTGGAGGAAAAATGTGAAGAAAAC
CATTAAGTTTTAAGTCTTTAGTCAGAATTTAGATAGAAACTAAGACAAATTGTCGCTTCT
ATGGCTAAAAAAGACAGAACTTAAAAAATAGAAATTATCAAAAAAAAGCTTGCATCAGAG
GAATTTAAAAGACCTAACTTTAAAGAACATCCTTTTTGTTTAAACCCAAATTTAATGATT
GTAGAATCAATTCATTAGCAATCAACTGTTTTTAAGAGTGCTATGGCTCCAATAAAAATG
ACATTTACATCTTACCCAATTGGTTAAAAGGAGAAGGAAGGCAAAGTAGAAATGATCTAT
AAGAACGGTGATGATTTGAGACAAGATTAGCTTGTTATGTAAATATTTAACCTCATGGAT
GGATTACTTAAAGGAGTTGGTTAGGATTTCAGGCTAATGCCTTATAAGGTACTTGCATGT
TCAAAAAACGATGGATTTATGGAATTCGTGCCTAATTCTACTACTATTTAGGATTTGCTA
AAAGGAGGCAAGTAATTTTCTTAGTATTTGTAAAACTTAGCTGCAAATCCCGAAAATCCT
ATATACGAAGAATACAAACGCTTAAGAATGTAAAATGATGAATAAGGAAAGCTAAGTAAT
ATAGAATATGTCAGTCAAAAAATAATGGAAAATTATATGCTCAGTTGCGCAGGTTATAGT
GTAATGACTTATTTCTTAGGTGTGGGTGATCGTCACTTAGAAAATTTGATGGTTGATATT
ACAGGAAAATTTTTCCATATTGATTTTGGGTTTATTCTAGGACAAGATCCTAAACCTTAC
CCACCACCTTTGAAATTATGTAGATAAATGATCGAAGGTATGGGAGGAAAGGATAGTAAA
GTTTATGCAGAATTTAGAAAGAAATGTGTACATGCTTACATATATTTAAGAAAATATGCT
AAATTGATTGTAAATTTATTCCATTTAATGATAGACTCAGGTATTAAGGATATGAGTATT
GAAGCACTCGAAAAGTTAGCTGAGAAATTTTACTTGGATTTCAACGATACTCAAGCAGAG
CTGCATTTCTTGAATATTTTAGATGAAAGTGAAACAGCTCTTTTTGCTAGAGTTACAGAT
ATGATTCATAAATGGGCCACTTATTGGAGAGCTTGA


>TTHERM_00649380(protein)
MKKGPTEYIQHTLLDQLPVKFKICCINDQKKVLRYFFNDEDGSSKLENLEAMVTAQLVVN
EKKIQPAQQTLFIDRMLFEQNIIFNYKYKDLSYNSIIAITLWCSQKNKDEKKPLGCTTIS
LFDDQFRLRQGKYHLYIWPDTLPDTSYTSITPGLVTDDNIKQINFSHQKTEQAFTNVNKF
PQKTGSSIHRNQLKEQLDLQKIYAFQKIPSAFLEIDFPNFETLVLYQEPEYIIDNDLSSK
EINNSQSNSSTNSNQQSLTGGKSSKFFIQEVDFSECVVTSDFDYENRKDDLIQEQTALII
REDENPQQLKPSKNELQIIENSIKKPILGELKQDEKLLFYRFRYSLVQNPEALVKFLHSI
NWDNQKELNEAKKLLKIWAKCSYGDALHLLSSSFCANEFYNKKYKKPQDTAIYIRKYACE
QLEKEQTSTICSILLQLTQALRYEPFDYQKSHLAQFLVKKACENTEIATLFYWYLLVECD
KEMDLKEKAKLSSTNQKVQEWFNQVFERMNEELEEKCEENHQVLSLQSEFRQKLRQIVAS
MAKKDRTQKIEIIKKKLASEEFKRPNFKEHPFCLNPNLMIVESIHQQSTVFKSAMAPIKM
TFTSYPIGQKEKEGKVEMIYKNGDDLRQDQLVMQIFNLMDGLLKGVGQDFRLMPYKVLAC
SKNDGFMEFVPNSTTIQDLLKGGKQFSQYLQNLAANPENPIYEEYKRLRMQNDEQGKLSN
IEYVSQKIMENYMLSCAGYSVMTYFLGVGDRHLENLMVDITGKFFHIDFGFILGQDPKPY
PPPLKLCRQMIEGMGGKDSKVYAEFRKKCVHAYIYLRKYAKLIVNLFHLMIDSGIKDMSI
EALEKLAEKFYLDFNDTQAELHFLNILDESETALFARVTDMIHKWATYWRA


>TTHERM_00649380(gene)
ATGAAAAAAGGACCAACAGAATATATTCAACATACTCTTTTAGATTAACTTCCAGTAAAG
TTTAAAATATGCTGCATTAATGATTAAAAAAAAGTCTTGAGGTAATTTATAATTTTAGTA
AAATCATTAATCTTAATATAAAGCCAATTTATTATTCTAAAATAAAGAAAATTACGAAAT
AAAACTCAGTTTAAAAATTATTTTACCCAAAAAATTTGTTAAACTAATTTAATTTTTTCG
CTAAAACATTTTAGCCAATCAAAAATATAGATCTAAAAATTTTTCTTTGAATAAATTTGT
AAAATAGATACTTTTTTAATGACGAAGATGGTAGCAGTAAATTAGAAAATTTGGAAGCAA
TGGTAACAGCTTAATTAGTTGTAAATGAAAAAAAAATATAGCCAGCATAGCAAACACTAT
TTATTGATAGGATGCTTTTTGAATAGAATATTATTTTTAATTATAAGTACAAAGATTTGA
GTTATAATTCTATTATTGCAATTACATTATGGTGTTCCCAAAAAAATAAAGATGAAAAAA
AACCTTTGGGATGCACAACTATAAGTCTTTTTGATGATTAATTTCGTTTGAGATAAGGGA
AATATCATTTATATATATGGCCAGATACTCTACCTGATACTTCTTATACTTCTATAACTC
CTGGATTAGTGACTGATGATAATATCAAGTAGATCAATTTCTCACATTAAAAAACAGAAT
AGGCCTTTACAAATGTAAATAAATTTCCATAAAAGACTGGCTCATCTATCCATAGAAACT
AACTTAAAGAATAGCTTGATCTTTAAAAAATTTATGCTTTTCAAAAGATCCCTAGTGCCT
TCCTTGAAATAGATTTTCCAAATTTTGAAACATTGGTGCTTTACCAAGAGCCAGAATACA
TAATTGATAATGATTTAAGTTCTAAAGAAATAAACAATTCTTAATCTAATTCATCAACAA
ATTCCAATCAATAATCACTTACTGGTGGTAAATCTTCTAAGTTTTTTATATAAGAAGTAG
ATTTTTCAGAATGCGTAGTTACATCTGATTTTGATTATGAGAATCGTAAAGATGATTTAA
TTTAAGAGCAAACTGCCCTTATTATTAGAGAAGATGAAAATCCTTAATAGCTAAAACCAT
CTAAAAATGAATTACAAATTATAGAAAATTCAATAAAAAAACCCATTTTAGGCGAATTGA
AGCAAGATGAGAAGCTCTTATTTTATAGATTTAGGTTATTCTTTTAAATAATTTATTTTT
TGATGAATTTTTATGTCAAAAACTTTTCAATTTTATGATTAAAATTAAAAATTATTTTTA
TTTTTTTTGTAATTAAATTTTATTTTATTTTATTTTAGATACTCTTTGGTTTAGAATCCT
GAGGCCTTAGTAAAGTTTTTGCACTCAATTAATTGGGATAACTAAAAAGAATTAAATGAA
GCTAAGAAATTATTGAAAATTTGGGCAAAATGCTCATACGGAGATGCTTTGCACTTACTT
TCAAGCTCATTTTGTGCAAACGAGTTCTATAATAAAAAATATAAAAAGCCATAAGATACT
GCAATATATATACGTAAATATGCTTGTGAATAACTGGAAAAAGAATAAACATCAACAATT
TGTTCAATTCTATTGTAGCTTACACAAGCTTTAAGATATGAACCTTTTGATTATTAAAAA
AGTCATCTTGCTTAATTTTTAGTAAAAAAGGCATGCGAAAACACAGAAATAGCTACACTG
TTTTATTGGTAATTAAATTGTTTACTTAATTTAAATCTTGATATTATTTATTCTTTATAT
ATGCTAATAATCTAATTAATTTTAGCTTACAGCTTAACAGAAAAATTATTTATAATTTAA
TTAAGGTATCTTTTAGTCGAATGTGATAAAGAAATGGACTTAAAAGAAAAAGCAAAACTT
AGTTCTACTAACTAAAAAGTGTAGGAATGGTTTAATTAAGTATTTGAAAGGATGAATGAA
GAATTGGAGGAAAAATGTGAAGAAAACCATTAAGTTTTAAGTCTTTAGTCAGAATTTAGA
TAGAAACTAAGACAAATTGTCGCTTCTATGGCTAAAAAAGACAGAACTTAAAAAATAGAA
ATTATCAAAAAAAAGCTTGCATCAGAGGAATTTAAAAGACCTAACTTTAAAGAACATCCT
TTTTGTTTAAACCCAAATTTAATGATTGTAGAATCAATTCATTAGCAATCAACTGTTTTT
AAGAGTGCTATGGCTCCAATAAAAATGACATTTACATCTTACCCAATTGGTAATCTTAAT
TAAAATTTGAAATAATTTTACATTACACATAAATATCAATTATTTATCAATCATCTTTTA
TTTATAAGCTTTAAAAATTCAGTTTACATTCAAGTACTATTTAATTGAATAAAATTTCAT
TTCGATTCAAGCAACAAAAAAAGAAAATATCCATTTAATTTTTTTTTTACAATTGTAAGT
TATGTATTCCTATCAAATATTTGAAAGCAACAACTTACAACTTAATTAACAATATTTTAT
CCTAAAAAATAATGAATAATGCTTAAAATAATTAAAATACTAATCCATAAAATACAAATA
AAATACTACATTTCACACAATCACAATCAAGAAAAATAATGATAAAAATTTATTATTATT
AGCTGTTTAAAAAATAAACTATGCAAACTAATTTATTAGAATTTTATTAATAATCAATTA
ATATTCGTTTAAATTAATTTACAATCTAGTTAAGCTATAGAGCGGACTTAACTTCTAATA
GAGAATAACTACCCTTATAAATTCAGTTTTTATAATGAAAATATATCTTAAAAAGTCTTT
TATAACCCAATATCAAAAATAAAACAAAAGATATTTTGTCATATTTTATATTTAAAAAGA
AATTTTTACTTTTTATGATTCAATATAAAAAGTTTTACTAGATAAATTGGGTTTTCAATT
TCTTTTATAGAATTTAATCTGATTAATACTGCTTCTTTTAAAACTAAGAGTGAATCATGA
ACAAACTTTCATTTTAATTTTACAAAAGGTTAAAAGGAGAAGGAAGGCAAAGTAGAAATG
ATCTATAAGAACGGTGATGATTTGAGACAAGATTAGCTTGTTATGTAAATATTTAACCTC
ATGGATGGATTACTTAAAGGAGTTGGTTAGGATTTCAGGCTAATGCCTTATAAGGTACTT
GCATGTTCAAAAAACGATGGATTTATGGAATTCGTGCCTAATTCTACTACTATTTAGGAT
TTGCTAAAAGGAGGCAAGTAATTTTCTTAGTATTTGTAAAACTTAGCTGCAAATCCCGAA
AATCCTATATACGAAGAATACAAACGCTTAAGAATGTAAAATGATGAATAAGGAAAGCTA
AGTAATATAGAATATGTCAGTCAAAAAATAATGGAAAATTATATGCTCAGTTGCGCAGGT
TATAGTGTAATGACTTATTTCTTAGGTGTGGGTGATCGTCACTTAGAAAATTTGATGGTT
GATATTACAGGAAAATTTTTCCATATTGATTTTGGGTTTATTCTAGGACAAGATCCTAAA
CCTTACCCACCACCTTTGAAATTATGTAGATAAATGATCGAAGGTATGGGAGGAAAGGAT
AGTAAAGTTTATGCAGAATTTAGAAAGAAATGTGTACATGCTTACATATATTTAAGAAAA
TATGCTAAATTGATTGTAAATTTATTCCATTTAATGATAGACTCAGGTATTAAGGATATG
AGTATTGAAGCACTCGAAAAGTTAGCTGAGAAATTTTACTTGGATTTCAACGATACTCAA
GCAGAGCTGCATTTCTTGAATATTTTAGATGAAAGTGAAACAGCTCTTTTTGCTAGAGTT
ACAGATATGATTCATAAATGGGCCACTTATTGGAGAGCTTGA