Identifiers and Description

Gene Model Identifier

TTHERM_01124000

Standard Name

VPS26 (Vacuolar protein sorting-associated protein 26 )

Aliases

PreTt03054 | 244.m00040 | 3834.m00402

Description

VPS; Vacuolar protein sorting-associated protein; retromer subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF01390 ) SEA domain
  • ( TIGR01612 ) rhoptry protein
  • ( PF00246 ) Zinc carboxypeptidase
  • ( PF04702 ) Vicilin N terminal region
  • ( PF07710 ) P53 tetramerisation motif
  • ( PF01727 ) Domain of unknown function
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF00339 ) Arrestin (or S-antigen), N-terminal domain
  • ( PF03643 ) Vacuolar protein sorting-associated protein 26

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01124000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15878.19.997093137033517e-262vacuolar protein sorting-assoc
iated protein 26 containing pr
otein (1276 aa)
DictyBaseDDB_G02691689.995417076252815e-72vps26 on chromosome: 1 positio
n 4319399 to 4321235
OxytrichaContig20025.0.g871.99927841627239e-68Vacuolar protein sorting-assoc
iated protein 26
WormBaseWBGene000069311.0000310450948521e-65locus:vps-26 status:Partiall
y_confirmed UniProt:B3GWB9
protein_id:CAQ58124.1
SGDYJL053W2.0005131442217614e-40PEP8 Vacuolar protein sorting
protein that forms part of the
multimeric membrane-associate
d retromer complex along with
Vps35p, Vps29p, Vps17p, and Vp
s5p; essential for endosome-to
-Golgi retrograde protein tran
sport
Stentor CoeruleusSteCoe_303536.054601895401186e-39

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01124000(coding)
ATGGTAGGATTTAAATTAAATATTATTTCGATTTCATAAAAGTCTAGCAACCCAATAAAT
TAGCAAAATACCTTACATATAAAAAATCACAGTTTTCTAACACTATTTTAAATAAATCAT
TAATAGTCATTTTTCGGTTTTGGCAATTCAGGTGCAAATATTACTATTGAATTAGATGGT
CTTGAAAAGAGAAAAAAAACTACTATTAGACCTAAGGGATAAGAACCTTTTAAGCTTCCC
GTTTATACAGGTGATGATGATATTAGTGGTTTAATAGATATTAGAATTAAGGGTAAAAAA
TTAGAACATCAAGGTATTAGAGTTGAACTAGTTGGTCATATAGAGGTTACTTATGACAAC
AAGCAAAATAGCGATTTTATGAGCATGGCCAGAGAATTGGAACCTGCTGGTACTTTATTC
GAAGATAAAAAATTCAAATTTTTATTCCCCAAGTTTGAAAAGACCTTCGAAACTTACTAT
GGTAAATCTGCAAAGGTTAGATACTTTTTGAGAGTAAGTATCAACAAACAATATAACTAA
AAAATTGTTTAAACACTTGATTTTGCTGTCGTCCTTCCTAGCTAAGACTCAGATAAAATT
GAAACTAATCCTATCAAGCTTGAAGTCGGTATTCAAGAATGTCTTCATATCGAATTCGAA
TTTTCTAAAGATAAATACCACTTAAAAGATTGTTTGATTGGAAAGGTTCACTTCTTATTA
GTTAAAATAAGAATTAAACATATGTAATTGTAAGTTATCCGTCAAGAAATCACTCTCAAT
AATGGAGTTGTAAATAAAGATAACGAAGTTTTAGTAGATTATGAAATTATGGACGGCTGC
CCTAGAAAAGGAGAAGTTATTCCCATCAGATTGTATCTCAGTGGTGTTGACTTGACTCCT
TCTTATTCAGAAAGTACTTCTAATAAATTCCAAGTGAAACATTTCATCAACTTAATTTTA
ATTGATGATGAAGGAATTATTGCTAAAAACAACTTCTTATTTCAAATGCTAGGTTATTCC
TAATTCGCTCTAAAAAAGCTGTAAAATCCAAATGAATTAGTTGAAAGTGGTAAATACTAG
CTTGATGGTAAAATTAAGTTAAAGTTTATTGATTTAGATATTGAAACAATGGACTTAATG
ATGGAAAGAAAATAAGAATCAGACTATTAATTGTATTGGAAATCTTTAAACTCTTAAAAA
AGGGAAAATTTGGTGTATAGAGGAGAAGAACAAGAAAAAAAAGACCATGAGTGTATTCTA
GATGAGAAAAACTGTAGGTGTAAAATATGTGGTAGATGCCTTAAATGGACTACTTATGGA
ATCATTAGAGATTTAGAGCCTTTTGAATAAAAGATGAAAAAAATGGATATAGATTATTAC
AAATATGAAAGCATTTTAAATAAAATAAACAAATAAATAGAGTTATAGCAATTATTATAA
GACTAAAAAGTTTTTTCAATTAGAAATTTTACTTAATTTAAAAATGCTAGTTAAATGAGA
GACTTTATTTACTTCACACTGTGCTTACCTCTAAGCTATGGATTTACTAATTAAATTAAA
GCATACAAAGACAGGTAGAGATTTATATCAAGACCTAGCAACTTTAATTTATCATTTCTA
CACAATTAAAATTTATTAACAGATCAAATAGCTTAAAACAATGTCATATTTTCCAATACA
CTTTAGAATGCAAAAAATGATGCCAATAAAAATGAGAACTAAATAAAAAATCTTAGTTAA
AATAATCAATACAAAGCAGCTTATTACTCTTCGACTAGATTCAGTCTTTTAATTTAAAAT
GACAAATAAATTTAACCTCCTCTTAGTATCAGAGATCTTTAAATAGAGGGTAATCAACAT
CCTGACTTTGAAATATTTGGAGATTTTGAATGTGCTAATTTTTTGCATGCCTACTATGAT
CCTAAAAATTTAAAAGTTTAAATTATATTAAAAGCTGACACTAATACTGATGGCTTTACT
TCTTGGTTTTATTTTGGTTTAAAAGTTAAAACAAATGAACCTTTACGTCTGAATTTTGAA
ATACTGAACTGCAGAAAAGAAAAATCTTTATTTCAATAAGGTATGAATGTTTGCATTGCT
AGACTCAACGATAACATGATTTACAGCAATTTTAACAATTAATTAAGAACTTGGAGAAGA
GACATGGCTTTTGATATTAAGTATCAATAATCTACTTATCCAAGAAAAGTTTTCAAGAGG
ACGTCTTCATTTAGAATTTTACCAGTAAATGACTTTGTTGAAGTTGATAATACATTTTTT
CCTGAAAATCCTTAAATTGAAGAGAGATGTACAAAGATTTTAGAGTTAAAACAAGCTGGA
TTAGACGTTTCAAGCTAAATGGATAAGTTTTACAATTATAAATTAAAAGACAAAAAGTTT
ATTAAAAACTATTTTCATGGACTTTCATTTATATATTAATTTTAAATTAACTCTAAAGAT
TCTACTATCCTATTCTCGTAAGCTATCCCTTACACCTTCTCAAATTTAATAGAATTTATA
GAAAATATAGAAGCAACTATTAAATAGTAAAATCCTTTGTTCAGGTACTCTTTTAATAAT
GACACAAGAGTTTATACAATTGATACTTTTAATTTTATTTATGAAAAGACAATAATTGGC
GCTTCTATTATAGGTTTGCCTATTACAGAAATACAAATAACATCATAAAACTCTGTAAGA
GCCCTTCCAATTTAAAAGAGGCCATACATAATTATAATCGCAAGATAACATCCAAATGAG
ACTCCAGGGAGCTTTGTTTGCTAAGGCTTTATAAAATTTTTACTCAGCTCTGAACCTGAA
GCTATTTCATTAAGATAAATGTTTATTTTCAAGATCATTCCAATGGTAAATCCAGACGGA
GTAGTTGTGGGAAACAGTAGAGCCTCAGTAAAGGGAGTTGATTTGAATAGAGGATGGGAA
TTTAGTGATAGCAATAATTACCCAGAGATTCATTGCATAAAATAGAGAATTTAATAATTA
AATGATGAAAACAAAAGTGTATATATGTTTTTAGATTTACATGGTCATACTGTAAAACCT
GGTAGCTTTTTATTGTGTACATTAAAAGAAGATTCTTCAAACCTTGAATGGGCAAAGGTG
CGTCTCTTTCCAAAGGTTATTGCTGAAAATTGCAAATTTTTTGATATCAGTAGTTGCAAA
TATTCTTTTATATCAACTCATAAGAACTGTTGTGCACGTGAATATGTTTGGAGAGACTTG
AAAGTAGAAAATTCTTATACCTTGGAAACCTCATTTTTTGGAAGTAAAGAAGTTTTTAAT
GGCCTAAAAATAGGTGATAATTTGATTATTGATCAATCAGATAAATCAATAAAGCACTTT
AGTGTTTAAGATTATGAATATATTGGATAGTAAGTTTGCAAGTCTATATTACAGTTTTCT
GGCTGCCTTACGTTGATGATAGAGTAAGCCTAGTTGAATGAAAAATTAGACATTGATGAA
GAAACTTTATTAACAGGGCAAGCTCCATAAGAATTGGAGATCCCTCAAGAAGAATTAAAT
AAAATATAAGAAATGACTATTTCAAAAAAGTATTAATAAAATCTTTAGAATTTAAGCAGT
GATAGCTCTATATTAAGGTCAACTTAAATAAAAAGTATCTTTAATAAAGACTCATTGTCA
CCTAAAGTTAAAAAGAATATAAAATCAGCTTCAATAGCTTTGTCTTAAATTTTAAGATTG
AAATAGATGGTTGATGAGAAAGAAAAATTAAAAGACATTTAGCTCTTTACTGACCATAGA
GCTGATTCATTAACAATATCTAATTAAGTAAGTTTCTAGGATATAGAATCAGAAGAATAC
TAGTAAGCTATCACAAATCAAGAAGACAATCAGTAGTAAGTGATAGTAAATATAGATTTG
ATGAATTAAAGCTCATCAAAAACAGAGGAGTAAGCTAAAAGAGTTTTGAATGAGATGAAA
CAAAGTACATAAAATGATGATAAAATTTAATAAAAAACTATTTCTAAAGAATAATCTTAT
CCCACAAATAACTAAAATAAAGCTAATCAAAAAAGTTCTTTGAATAAATTTTAAAAGTAC
GTGCTTTAAACTAAAGAGCAAATAAAGGTTCTTTTTGCATTAAAAAAAGGTTTGGAATGG
AATAAATTTTACACCTAAAAAGATGCTGAAGAACTTAAAGAATTTAAAGAGTAAAAACAA
CAACTAAAGCAAAACAAAGAACCTAGAATTGAATAATAATAACTCAATCAATCAAGTTAA
AGTCAAGCTAAGGCTGATATTGAAGCAGATCTTGAAACTGATAATGCTAACACAAATGAT
GAGGAGGTTAATTTAAAACAATCAGGTGATAAAGATAGCGATTCTGAACCTGAAGACGAC
TGCAGAAAATAAAATAAACATAATGGTTTAAGTTAAAATACTTAATAAAGCTAATAAAAT
ATTAGTTGTAATTTTAGACTTTAAACAGATGAATCAGAATAAACTTAATCTGATAAAATA
AAAAATGATAATTTATAAAATGAATTAGCATATGGGCAATAAAATAATTAAAAACAAGAT
AACTCAGATGAATCATTAAATAAAAACGGTTTAAATTAAGATGGCATTGATCTAAACGGG
AAATAAAATGAAGATAGCAAAAAAAATAAAAATGAAATGGGTAATAATATGAATGACAAT
ATTAATTTTAAATAAAAAGGAAGAAATACAAATGGCAAGAAGTTAAGAGGTGATAGAGAT
GGAGTATCTGGTGATGAGAATACTAAAAATTAAAATCTTGAAAAATTTTTCCTTTAAACT
TCTAAATATAATTTTGGGCAGGCATTTTTATAGAGAAATTAAATAGAAAAAATTAAATTA
AAATCTCCCTTTTTGCCCTCATAAGATGAGATTTTTGAAGCTTATTCCTTGAAATCGCCA
AAAAACTTACAGAATTTAAGCATGAAGAAGTTGATGACAGACTTTAATCTCACCCTTTTC
CCGAATCTATCTCAACAATTCAATATTGAAGAAGAAAGAAAAAATGAAATGCAATAAATG
AATATTGTTAATGACAATGAATAGTCTGAAAATGATGAAAGCAATATTAATTTTAGAAAA
ATATCTGAAATACAAATTTAGGACTAGTTTATGTTTTTTGATGTTTCTCAAAAAATATCT
TTAAATACAAGTCCTATAATATCTCCAATCAACTAAAATAAATTATTAGATCCTTAAAGC
ATTTAACTGAATACAGAAAATAATCAAAATAAGAATTTGTAACAAAATGAATAAAAATTA
TTTAGTAACCCATCATATGATAAAAGTTAAGGTTGTCAAATTTCTCAGTAAGATCAAATT
AGTATCGAAAATGATTATGTAATAGAAGAATAATAATAAAATAATACCCAGAAAACTAAT
AAATTATAATAAGATTTACATTCTCTACAGTTATAAAAAGATTACTCTATTTTTAAAATT
AATAAAGCCACTTCACTAAAAGAAGGTATGGAAAATCCTTTGACAGTTTAAACACCTTTA
CAAAATTCAATTTATGGAGGCATAATAGCTGCAATACAACAAGATCCCAATTCTCCTGCA
TAAAAATCAATATATAAATAAAACTCAACTTTAAATAAAATCACTATACCTTCAAGCTAA
AAATAATCCTCATCTCCGATAAATAAAGCAATTATTGCATACAGACCTCCTTCAGGTAAT
GTCTGGAATACAGCCAAAGGATTAAGGGATGCTAATTCTCCTGTTTTTCAAAGTAATAAA
TAAGAACTTTAAGAAGACAACCAAATTGACTCAAGTTCTTAGATTTTATCTAAAACACCT
ACTTAAAAAGCAAGATCTATAAACTAAAGCAATTCGTAACCATCTTTTAGGATTAAATAA
AATAATGTAAATAAAGCGTACAAAGATTTTATACAATAATAGTAGAATAAAACGCAAAAG
TAATCATAGCCTACAGAATTAAAAAGGTAGTAAACCAGCCTAAAAAAACAATCCTCACCT
TCCAATTCAGATGAAAGATCCTAACTATCTTCTTAATAATAAAGTTAATATTATATTTTA
CGAAATTCTGCAATAAATTTTAGCTAAGCTTAATCATCTTAAACATATAATTCTTGA


>TTHERM_01124000(protein)
MVGFKLNIISISQKSSNPINQQNTLHIKNHSFLTLFQINHQQSFFGFGNSGANITIELDG
LEKRKKTTIRPKGQEPFKLPVYTGDDDISGLIDIRIKGKKLEHQGIRVELVGHIEVTYDN
KQNSDFMSMARELEPAGTLFEDKKFKFLFPKFEKTFETYYGKSAKVRYFLRVSINKQYNQ
KIVQTLDFAVVLPSQDSDKIETNPIKLEVGIQECLHIEFEFSKDKYHLKDCLIGKVHFLL
VKIRIKHMQLQVIRQEITLNNGVVNKDNEVLVDYEIMDGCPRKGEVIPIRLYLSGVDLTP
SYSESTSNKFQVKHFINLILIDDEGIIAKNNFLFQMLGYSQFALKKLQNPNELVESGKYQ
LDGKIKLKFIDLDIETMDLMMERKQESDYQLYWKSLNSQKRENLVYRGEEQEKKDHECIL
DEKNCRCKICGRCLKWTTYGIIRDLEPFEQKMKKMDIDYYKYESILNKINKQIELQQLLQ
DQKVFSIRNFTQFKNASQMRDFIYFTLCLPLSYGFTNQIKAYKDRQRFISRPSNFNLSFL
HNQNLLTDQIAQNNVIFSNTLQNAKNDANKNENQIKNLSQNNQYKAAYYSSTRFSLLIQN
DKQIQPPLSIRDLQIEGNQHPDFEIFGDFECANFLHAYYDPKNLKVQIILKADTNTDGFT
SWFYFGLKVKTNEPLRLNFEILNCRKEKSLFQQGMNVCIARLNDNMIYSNFNNQLRTWRR
DMAFDIKYQQSTYPRKVFKRTSSFRILPVNDFVEVDNTFFPENPQIEERCTKILELKQAG
LDVSSQMDKFYNYKLKDKKFIKNYFHGLSFIYQFQINSKDSTILFSQAIPYTFSNLIEFI
ENIEATIKQQNPLFRYSFNNDTRVYTIDTFNFIYEKTIIGASIIGLPITEIQITSQNSVR
ALPIQKRPYIIIIARQHPNETPGSFVCQGFIKFLLSSEPEAISLRQMFIFKIIPMVNPDG
VVVGNSRASVKGVDLNRGWEFSDSNNYPEIHCIKQRIQQLNDENKSVYMFLDLHGHTVKP
GSFLLCTLKEDSSNLEWAKVRLFPKVIAENCKFFDISSCKYSFISTHKNCCAREYVWRDL
KVENSYTLETSFFGSKEVFNGLKIGDNLIIDQSDKSIKHFSVQDYEYIGQQVCKSILQFS
GCLTLMIEQAQLNEKLDIDEETLLTGQAPQELEIPQEELNKIQEMTISKKYQQNLQNLSS
DSSILRSTQIKSIFNKDSLSPKVKKNIKSASIALSQILRLKQMVDEKEKLKDIQLFTDHR
ADSLTISNQVSFQDIESEEYQQAITNQEDNQQQVIVNIDLMNQSSSKTEEQAKRVLNEMK
QSTQNDDKIQQKTISKEQSYPTNNQNKANQKSSLNKFQKYVLQTKEQIKVLFALKKGLEW
NKFYTQKDAEELKEFKEQKQQLKQNKEPRIEQQQLNQSSQSQAKADIEADLETDNANTND
EEVNLKQSGDKDSDSEPEDDCRKQNKHNGLSQNTQQSQQNISCNFRLQTDESEQTQSDKI
KNDNLQNELAYGQQNNQKQDNSDESLNKNGLNQDGIDLNGKQNEDSKKNKNEMGNNMNDN
INFKQKGRNTNGKKLRGDRDGVSGDENTKNQNLEKFFLQTSKYNFGQAFLQRNQIEKIKL
KSPFLPSQDEIFEAYSLKSPKNLQNLSMKKLMTDFNLTLFPNLSQQFNIEEERKNEMQQM
NIVNDNEQSENDESNINFRKISEIQIQDQFMFFDVSQKISLNTSPIISPINQNKLLDPQS
IQLNTENNQNKNLQQNEQKLFSNPSYDKSQGCQISQQDQISIENDYVIEEQQQNNTQKTN
KLQQDLHSLQLQKDYSIFKINKATSLKEGMENPLTVQTPLQNSIYGGIIAAIQQDPNSPA
QKSIYKQNSTLNKITIPSSQKQSSSPINKAIIAYRPPSGNVWNTAKGLRDANSPVFQSNK
QELQEDNQIDSSSQILSKTPTQKARSINQSNSQPSFRIKQNNVNKAYKDFIQQQQNKTQK
QSQPTELKRQQTSLKKQSSPSNSDERSQLSSQQQSQYYILRNSAINFSQAQSSQTYNS


>TTHERM_01124000(gene)
ATGGTAGGATTTAAATTAAATATTATTTCGATTTCATAAAAGTCTAGCAACCCAATAAAT
TAGCAAAATACCTTACATATAAAAAATCACAGTTTTCTAACACTATTTTAAATAAATCAT
TAATAGTCATTTTTCGGTTTTGGCAATTCAGGTGCAAATATTACTATTGAATTAGATGGT
CTTGAAAAGAGAAAAAAAACTACTATTAGACCTAAGGGATAAGAACCTTTTAAGCTTCCC
GTTTATACAGTATGAAAATAATCTTAAATAATCGTTTCGCTTAAAGCAATTATGATTTTA
TTAAAATATAAATAGGGTGATGATGATATTAGTGGTTTAATAGATATTAGAATTAAGGGT
AAAAAATTAGAACATCAAGGTATTAGAGTTGAACTAGTTGGTCATATAGGTAAAACCATT
GAGAAAAACTTTATTTTAATTTTAAAAAATTATTCTGTCTATTCGTTTTTTAAATTGAGG
AAATTATATTTAGAAATATTCTAAGACATAAAATAAAATCACATTCATTTTATTTTGAAA
ATTGCGAAAAGCAAGTTGATTAATAAAAAATACAATTTAAAGAATCAAAAGAAACAAAAT
TTTAATAAATTTACTTTTTTCTGAATATATTTAAAGAGGTTACTTATGACAACAAGCAAA
ATAGCGATTTTATGAGCATGGCCAGAGAATTGGAACCTGCTGGTACTTTATTCGAAGATA
AAAAATTCAAATTTTTATTCCCCAAGTTTGAAAAGACCTTCGAAACTTACTATGGTAAAT
CTGCAAAGGTTAGATACTTTTTGAGAGTAAGTATCAACAAACAATATAACTAAAAAATTG
TTTAAACACTTGATTTTGCTGTCGTCCTTCCTAGCTAAGACTCAGATAAAATTGAAACTA
ATCCTATCAAGCTTGAAGTAGATTTCCAAAATAAAATAATTTATTTAGTATTAAATATTT
AAATAATTAAATGATAGGTCGGTATTCAAGAATGTCTTCATATCGAATTCGAATTTTCTA
AAGATAAATACCACTTAAAAGATTGTTTGATTGGAAAGGTTCACTTCTTATTAGTTAAAA
TAAGAATTAAACATATGTAATTGTAAGTTATCCGTCAAGAAATCACTCTCAGTAATAAAA
AAAAATTGATATATCTTTATATATATTTTGCTAAAATATTTTTACCATTTACTAACTTAT
TTTGTTTTTTAAAAACAGATAATGGAGTTGTAAATAAAGATAACGAAGTTTTAGTAGATT
ATGAAATTATGGACGGCTGCCCTAGAAAAGGAGAAGTTATTCCCATCAGATTGTATCTCA
GTGGTGTTGACTTGACTCCTTCTTATTCAGAAAGTACTTCTAATAAATTCCAAGTGAAAC
ATTTCATCAACTTAATTTTAATTGATGATGAAGGTAAAAGATACTTTAAATAATAGGAAA
TATCTATGTATCGTAAGAAATGAATTAGATATATTTTTAATATATAAAATATTTAATATC
TTTGTTTTTAGGTGTTATTTTATTTTCATGTAGATTAAAAAAAAAGTTTTGATATCTCAA
ATTTTTTATTTTTAAAATTAATTTAATAATAATTGGTTAATGTTATTTTTTTTACTGTTA
ATAATTTTTTTGTAATCCTAGCACTTCTAAATTTTAAGAGATTTTTTAGATTAATTAATC
AAATTTTTTAGAATAAGAAAAATAAAAGTTGTAATTAATACATTAACATAAATTCTACTA
AAGTAATTTAACTGAAAAGGAATTATTGCTAAAAACAACTTCTTATTTCAAATGCTAGGT
TATTCCTAATTCGCTCTAAAAAAGCTGTAAAATCCAAATGAATTAGTTGAAAGTGGTAAA
TACTAGCTTGATGGTAAAATTAAGTTAAAGTTTATTGATTTAGATATTGAAACAATGGAC
TTAATGATGGAAAGAAAATAAGAATCAGACTATTAATTGTATTGGAAATCTTTAAACTCT
TAAAAAAGGTAAAAATCATTATAATCTTAAGATTAAAGCTTCATAGCTATAGAACAAGCT
TTAAAAAATATTTTTTAAATTTTATTCAAAGGTTAATCGCCGTAGCATATTTATTTTTTT
TAATAGTAGAAATAGAATATCAATTGAAATGTAAATTGAAAAATATTTTAATTAATTCTC
AGCTAGAAAGTATTTTCTTAAAAAATAAATAATATTTTTTCCTGAAAAAGTCAATTCATA
TTTTAAAATTATTCTGTTTTCTTCTTTACTGCATACTTCTACTAAAAATAAATAATTTAA
AGCACATTAATAGATAAAATTAAACACTGAATAAGGTTGATTCATTCCAAAAAAACCTAA
AAATACTTAATTTAGTATGAAGATGAATAGTCTTGAACTCTTAAATTTGCAAGAATATTT
ACAATAATTTTTTTTTTAGTTTTAAAGAAAACATTTATGATTTTTATAAAAATAATTAGG
GAAAATTTGGTGTATAGAGGAGAAGAACAAGAAAAAAAAGACCATGAGTGTATTCTAGAT
GAGAAAAACTGTAGGTGTAAAATATGTGGTAGATGCCTTAAATGGACTACTTATGGAATC
ATTAGAGATTTAGAGCCTTTTGAATAAAAGATGAAAAAAATGGATATAGATTATTACAAA
TATGAAAGCATTTTAAATAAAATAAACAAATAAATAGAGTTATAGCAATTATTATAAGAC
TAAAAAGTTTTTTCAATTAGAAATTTTACTTAATTTAAAAATGCTAGTTAAATGAGAGAC
TTTATTTACTTCACACTGTGCTTACCTCTAAGCTATGGATTTACTAATTAAATTAAAGCA
TACAAAGACAGGTAGAGATTTATATCAAGACCTAGCAACTTTAATTTATCATTTCTACAC
AATTAAAATTTATTAACAGATCAAATAGCTTAAAACAATGTCATATTTTCCAATACACTT
TAGAATGCAAAAAATGATGCCAATAAAAATGAGAACTAAATAAAAAATCTTAGTTAAAAT
AATCAATACAAAGCAGCTTATTACTCTTCGACTAGATTCAGTCTTTTAATTTAAAATGAC
AAATAAATTTAACCTCCTCTTAGTATCAGAGATCTTTAAATAGAGGGTAATCAACATCCT
GACTTTGAAATATTTGGAGATTTTGAATGTGCTAATTTTTTGCATGCCTACTATGATCCT
AAAAATTTAAAAGTTTAAATTATATTAAAAGCTGACACTAATACTGATGGCTTTACTTCT
TGGTTTTATTTTGGTTTAAAAGTTAAAACAAATGAACCTTTACGTCTGAATTTTGAAATA
CTGAACTGCAGAAAAGAAAAATCTTTATTTCAATAAGGTATGAATGTTTGCATTGCTAGA
CTCAACGATAACATGATTTACAGCAATTTTAACAATTAATTAAGAACTTGGAGAAGAGAC
ATGGCTTTTGATATTAAGTATCAATAATCTACTTATCCAAGAAAAGTTTTCAAGAGGACG
TCTTCATTTAGAATTTTACCAGTAAATGACTTTGTTGAAGTTGATAATACATTTTTTCCT
GAAAATCCTTAAATTGAAGAGAGATGTACAAAGATTTTAGAGTTAAAACAAGCTGGATTA
GACGTTTCAAGCTAAATGGATAAGTTTTACAATTATAAATTAAAAGACAAAAAGTTTATT
AAAAACTATTTTCATGGACTTTCATTTATATATTAATTTTAAATTAACTCTAAAGATTCT
ACTATCCTATTCTCGTAAGCTATCCCTTACACCTTCTCAAATTTAATAGAATTTATAGAA
AATATAGAAGCAACTATTAAATAGTAAAATCCTTTGTTCAGGTACTCTTTTAATAATGAC
ACAAGAGTTTATACAATTGATACTTTTAATTTTATTTATGAAAAGACAATAATTGGTAAC
ATCAAATTTTAATAAAGGAAGGATTTTATTTTTTATTTTTTTTTATATACTTCAGGCGCT
TCTATTATAGGTTTGCCTATTACAGAAATACAAATAACATCATAAAACTCTGTAAGAGCC
CTTCCAATTTAAAAGAGGCCATACATAATTATAATCGCAAGATAACATCCAAATGAGACT
CCAGGGAGCTTTGTTTGCTAAGTAATAAATAAATAAATAAAATAAGAATAAAATAAATAA
TTAAATTTTAAAAAAAGGGCTTTATAAAATTTTTACTCAGCTCTGAACCTGAAGCTATTT
CATTAAGATAAATGTTTATTTTCAAGGTAATTTTAGTTTTTACTTGATTTAAAATTTAAC
AACAGTTAAAAAAAAGATCATTCCAATGGTAAATCCAGACGGAGTAGTTGTGGGAAACAG
TAGAGCCTCAGTAAAGGGAGTTGATTTGAATAGAGGATGGGAATTTAGTGATAGCAATAA
TTACCCAGAGATTCATTGCATAAAATAGAGAATTTAATAATTAAATGATGAAAACAAAAG
TGTATATATGTTTTTAGATTTACATGGTCATACTGTAAAACCTGGTAGCTTTTTATTGTG
TACATTAAAAGAAGATTCTTCAAACCTTGAATGGGCAAAGGTGCGTCTCTTTCCAAAGGT
TATTGCTGAAAATTGCAAATTTTTTGATATCAGTAGTTGCAAATATTCTTTTATATCAAG
TAAATATGTTCTTTTTTTAAAAAACAATTTAAAGTAGTTGTTAAATAAAATTAGCTCATA
AGAACTGTTGTGCACGTGAATATGTTTGGAGAGACTTGAAAGTAGAAAATTCTTATACCT
TGGAAACCTCATTTTTTGGAAGTAAAGAAGTTTTTAATGGCCTAAAAATAGGTGATAATT
TGATTATTGATCAATCAGATAAATCAATAAAGCACTTTAGTGTTTAAGATTATGAATATA
TTGGATAGTAAGTTTGCAAGTCTATATTACAGTTTTCTGGCTGCCTTACGTTGATGATAG
AGTAAGCCTAGTTGAATGAAAAATTAGACATTGATGAAGAAACTTTATTAACAGGGCAAG
CTCCATAAGAATTGGAGATCCCTCAAGAAGAATTAAATAAAATATAAGAAATGACTATTT
CAAAAAAGTATTAATAAAATCTTTAGAATTTAAGCAGTGATAGCTCTATATTAAGGTCAA
CTTAAATAAAAAGTATCTTTAATAAAGACTCATTGTCACCTAAAGTTAAAAAGAATATAA
AATCAGCTTCAATAGCTTTGTCTTAAATTTTAAGATTGAAATAGATGGTTGATGAGAAAG
AAAAATTAAAAGACATTTAGCTCTTTACTGACCATAGAGCTGATTCATTAACAATATCTA
ATTAAGTAAGTTTCTAGGATATAGAATCAGAAGAATACTAGTAAGCTATCACAAATCAAG
AAGACAATCAGTAGTAAGTGATAGTAAATATAGATTTGATGAATTAAAGCTCATCAAAAA
CAGAGGAGTAAGCTAAAAGAGTTTTGAATGAGATGAAACAAAGTACATAAAATGATGATA
AAATTTAATAAAAAACTATTTCTAAAGAATAATCTTATCCCACAAATAACTAAAATAAAG
CTAATCAAAAAAGTTCTTTGAATAAATTTTAAAAGTACGTGCTTTAAACTAAAGAGCAAA
TAAAGGTTCTTTTTGCATTAAAAAAAGGTTTGGAATGGAATAAATTTTACACCTAAAAAG
ATGCTGAAGAACTTAAAGAATTTAAAGAGTAAAAACAACAACTAAAGCAAAACAAAGAAC
CTAGAATTGAATAATAATAACTCAATCAATCAAGTTAAAGTCAAGCTAAGGCTGATATTG
AAGCAGATCTTGAAACTGATAATGCTAACACAAATGATGAGGAGGTTAATTTAAAACAAT
CAGGTGATAAAGATAGCGATTCTGAACCTGAAGACGACTGCAGAAAATAAAATAAACATA
ATGGTTTAAGTTAAAATACTTAATAAAGCTAATAAAATATTAGTTGTAATTTTAGACTTT
AAACAGATGAATCAGAATAAACTTAATCTGATAAAATAAAAAATGATAATTTATAAAATG
AATTAGCATATGGGCAATAAAATAATTAAAAACAAGATAACTCAGATGAATCATTAAATA
AAAACGGTTTAAATTAAGATGGCATTGATCTAAACGGGAAATAAAATGAAGATAGCAAAA
AAAATAAAAATGAAATGGGTAATAATATGAATGACAATATTAATTTTAAATAAAAAGGAA
GAAATACAAATGGCAAGAAGTTAAGAGGTGATAGAGATGGAGTATCTGGTGATGAGAATA
CTAAAAATTAAAATCTTGAAAAATTTTTCCTTTAAACTTCTAAATATAATTTTGGGCAGG
CATTTTTATAGAGAAATTAAATAGAAAAAATTAAATTAAAATCTCCCTTTTTGCCCTCAT
AAGATGAGATTTTTGAAGCTTATTCCTTGAAATCGCCAAAAAACTTACAGAATTTAAGCA
TGAAGAAGTTGATGACAGACTTTAATCTCACCCTTTTCCCGAATCTATCTCAACAATTCA
ATATTGAGTATTTATTTTATTTTAGAATAACAATTTATTTTTAATTTAATAAAATTTGAC
TAAAATAAAAAAATAAATTAAAATTTAGAGAAGAAAGAAAAAATGAAATGCAATAAATGA
ATATTGTTAATGACAATGAATAGTCTGAAAATGATGAAAGCAATATTAATTTTAGAAAAA
TATCTGAAATACAAATTTAGGACTAGTTTATGTTTTTTGATGTTTCTCAAAAAATATCTT
TAAATACAAGTCCTATAATATCTCCAATCAACTAAAATAAATTATTAGATCCTTAAAGCA
TTTAACTGAATACAGAAAATAATCAAAATAAGAATTTGTAACAAAATGAATAAAAATTAT
TTAGTAACCCATCATATGATAAAAGTTAAGGTTGTCAAATTTCTCAGTAAGATCAAATTA
GTATCGAAAATGATTATGTAATAGAAGAATAATAATAAAATAATACCCAGAAAACTAATA
AATTATAATAAGATTTACATTCTCTACAGTTATAAAAAGATTACTCTATTTTTAAAATTA
ATAAAGCCACTTCACTAAAAGAAGGTATGGAAAATCCTTTGACAGTTTAAACACCTTTAC
AAAATTCAATTTATGGAGGCATAATAGCTGCAATACAACAAGATCCCAATTCTCCTGCAT
AAAAATCAATATATAAATAAAACTCAACTTTAAATAAAATCACTATACCTTCAAGCTAAA
AATAATCCTCATCTCCGATAAATAAAGCAATTATTGCATACAGACCTCCTTCAGGTAATG
TCTGGAATACAGCCAAAGGATTAAGGGATGCTAATTCTCCTGTTTTTCAAAGTAATAAAT
AAGAACTTTAAGAAGACAACCAAATTGACTCAAGTTCTTAGATTTTATCTAAAACACCTA
CTTAAAAAGCAAGATCTATAAACTAAAGCAATTCGTAACCATCTTTTAGGATTAAATAAA
ATAATGTAAATAAAGCGTACAAAGATTTTATACAATAATAGTAGAATAAAACGCAAAAGT
AATCATAGCCTACAGAATTAAAAAGGTAGTAAACCAGCCTAAAAAAACAATCCTCACCTT
CCAATTCAGATGAAAGATCCTAACTATCTTCTTAATAATAAAGTTAATATTATATTTTAC
GAAATTCTGCAATAAATTTTAGCTAAGCTTAATCATCTTAAACATATAATTCTTGA