Identifiers and Description

Gene Model Identifier

TTHERM_00055970

Standard Name

VPS25 (Vacuolar Sorting Protein 25)

Aliases

PreTt12980 | 4.m00379 | 3707.m00026

Description

SNF7 family protein; localizes to vesicles during vegetative growth

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF03357 ) SNF7 family
  • ( PF04778 ) LMP repeated region
  • ( TIGR00190 ) thiamine biosynthesis protein ThiC
  • ( TIGR00162 ) conserved hypothetical protein TIGR00162

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00055970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01896.12.0006174947921314e-117SNF7 family protein (230 aa)
WormBaseWBGene000208661.9999391735788327e-19locus:vps-24 status:Confirme
d UniProt:Q9GYK4 protein_i
d:CCD72089.1
SGDYKL041W4.999617891954556e-16VPS24 One of four subunits of
the endosomal sorting complex
required for transport III (ES
CRT-III); forms an ESCRT-III s
ubcomplex with Did4p; involved
in the sorting of transmembra
ne proteins into the multivesi
cular body (MVB) pathway
DictyBaseDDB_G02847690.00000000000007997998332353294vps24 on chromosome: 4 positio
n 2459478 to 2460314
OxytrichaContig6271.0.g560.000000000004997916451710233Snf7

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000141

Sequences

>TTHERM_00055970(coding)
ATGTTCAAAAAGCTTTTTGGTGGTTCAGAAAAGCCTGCTCCTCCTCCTCCCCCTCAACCT
AAGAAGTTCAATGAAATGAGTAAGGAAGAAATGAGGGAAGTATAAAAGGAATTCAGAAAA
AAAATTAACACAGAAGTAAGAGAAGTTGATAAGCAGATTTTTAGAATCGATATGGCTAGT
AAGAAGGCTGAAGAAGACTTAAAAAGAGAAATAAAGAAAGGAGATAAAGCTGACAAATTC
GTTAAATAAACATATGCTAAGTAAGTTTTACAATGCAGAACCCAAAAGCAAAGATATATG
GCAAACAAGGCTAAGGTTTAGGGTCTCTAATATACTCTAGATAACTTCTTTGCTGATATT
AAACTAGCTTAAACCATGTAAAATACTGCTGGCATCATGAAAGCTATTAACTAATGCATC
AACATCAAGGAATTGCAAGTTTCTATGGCAGAAATGCAGAAAGAAATGGCTAAGATGGGT
ATCATTCAAGAAATGATGGATGATGCTATGGAAGCTGTTAACGATGATGTAGAGTTTGAT
AATGAGTAAGAAATTGATAGTTTAATTGATCAAATGGAAAAAGGTTTAAAAGAACCAAAA
TAAAATCAATTCAACCAAAACTTAAATCAAAATATTTAATAAAATCATGCACAAGAAGAA
GATGACTTCGATGCTCAACTAGCTGCACTTAAAAATTGA


>TTHERM_00055970(protein)
MFKKLFGGSEKPAPPPPPQPKKFNEMSKEEMREVQKEFRKKINTEVREVDKQIFRIDMAS
KKAEEDLKREIKKGDKADKFVKQTYAKQVLQCRTQKQRYMANKAKVQGLQYTLDNFFADI
KLAQTMQNTAGIMKAINQCINIKELQVSMAEMQKEMAKMGIIQEMMDDAMEAVNDDVEFD
NEQEIDSLIDQMEKGLKEPKQNQFNQNLNQNIQQNHAQEEDDFDAQLAALKN


>TTHERM_00055970(gene)
ATGTTCAAAAAGCTTTTTGGTGGTTCAGAAAAGCCTGCTCCTCCTCCTCCCCCTCAACCT
AAGAAGTTCAATGAAATGAGTAAGGAAGAAATGAGGGAAGTATAAAAGGAATTCAGAAAA
AAAATTAACACAGAAGTAAGAGAAGTTGATAAGCAGATTTTTAGAATCGATATGGCTAGT
AAGAAGGCTGAAGAAGACTTAAAAAGAGAAATAAAGAAAGGAGATAAAGCTGACAAATTC
GTTAAATAAACATATGCTAAGTAAGTTTTACAATGCAGAACCCAAAAGCAAAGATATATG
GCAAACAAGGCTAAGGTTTAGGGTCTCTAATATACTCTAGATAACTTCTTTGCTGATATT
AAACTAGCTTAAACCATGTAAAATACTGCTGGCATCATGAAAGCTATTAACTAATGCATC
AACATCAAGGAATTGCAAGTTTCTATGGCAGAAATGCAGAAAGAAATGGCTAAGATGGGT
ATCATTCAAGAAATGATGGATGATGCTATGGAAGCTGTTAACGATGATGTAGAGTTTGAT
AATGAGTAAGAAATTGATAGTTTAATTGATCAAATGGAAAAAGGTTTAAAAGAACCAAAA
TAAAATCAATTCAACCAAAACTTAAATCAAAATATTTAATAAAATCATGCACAAGAAGAA
GATGACTTCGATGCTCAACTAGCTGCACTTAAAAATTGA