Identifiers and Description

Gene Model Identifier

TTHERM_00474480

Standard Name

VMA9 (Vacuolar Membrane Atpase)

Aliases

PreTt02249 | 57.m00188 | 3709.m00048

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05493 ) ATP synthase subunit H

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00474480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13128.18.003017249547689e-39hypothetical protein (78 aa)
OxytrichaContig442.1.g30.0000000000019997478866288316ATP synthase subunit H
WormBaseWBGene000098820.000004000864880866421locus:vha-17 V-type proton A
TPase subunit e status:Confi
rmed UniProt:Q20591 protei
n_id:CAA92517.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00474480(coding)
ATGAGTGCTATTTTTGCAGGATCAATGATATTTATAGCTATCGCTGTTGTTGGTAGCATC
TTCTTTGGTTTTTATGCAAGAGCAAGAACCGTTGATATTACAGCAAAAGGTTCAAATGCA
TGCATTGCAGTTTTTTCAGTGATATTATCATGCATTTGTATGTGGATTATGTGGGTATGT
GCATATATGCATTAAATGAATCCAATTATTATGCCTTTGCTTAAAACCGATTGA


>TTHERM_00474480(protein)
MSAIFAGSMIFIAIAVVGSIFFGFYARARTVDITAKGSNACIAVFSVILSCICMWIMWVC
AYMHQMNPIIMPLLKTD


>TTHERM_00474480(gene)
ATGAGTGCTATTTTTGCAGGATCAATGATATTTATAGCTATCGCTGTTGTTGGTAGCATC
TTCTTTGGTTTTTATGCAAGAGCAAGAACCGTTGATATTACAGCAAAAGGTTCAAATGCA
TGGTAAATTATTCATAAACTTGAATATTTTGAAAATTATTATTTTACAAAATTAAAAATT
CTAAATGAATTTTTATAAAAAATTAATTATTTTTATTTAAAAATATTTAGCATTGCAGTT
TTTTCAGTGATATTATCATGCATTTGTATGTGGATTATGTGGGTATGTGCATATATGCAT
TAAATGAATCCAATTATTATGCCTTTGCTTAAAACCGATTGA