Identifiers and Description

Gene Model Identifier

TTHERM_00821870

Standard Name

VMA8 (Vacuolar Membrane Atpase)

Aliases

PreTt07746 | 140.m00061 | 3759.m00363

Description

V-type ATPase, D subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178

Molecular Function

  • ATPase activity, coupled to transmembrane movement of substances (IEA) | GO:0042626
  • proton-transporting ATPase activity, rotational mechanism (IEA) | GO:0046961

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.2%

TetraMine Data

TTHERM_00821870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17506.12.998539800509618e-166V-type ATPase, D subunit prote
in (254 aa)
OxytrichaContig13440.0.g1061.999618694399617e-70ATP synthase subunit D
WormBaseWBGene000101304.9995619603214884e-57locus:vha-14 V-type proton A
TPase subunit D status:Confi
rmed UniProt:P34462 protei
n_id:CAA81600.1
SGDYEL051W1.0004249259458435e-52VMA8 Subunit D of the eight-su
bunit V1 peripheral membrane d
omain of the vacuolar H+-ATPas
e (V-ATPase), an electrogenic
proton pump found throughout t
he endomembrane system; plays
a role in the coupling of prot
on transport and ATP hydrolysi
s
DictyBaseDDB_G02743313.998181939598921e-51DDB_G0274331 on chromosome: 2
position 3887023 to 3888186
Stentor CoeruleusSteCoe_45182.6102790696677047e-23

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00821870(coding)
ATGTCACAATAAATTACACCTAGTAGAATGACTCTTGCTATATATAAAGCAAAGACAGTC
TCTGCCAAGAAAGGTCACGAATTGCTTAAAAAGAAATGTGATGCTTTGAAGACCAAGTTC
AGAGCTATTATGATTGCTCTTTTGGAAAATAAGTTGAAGATGGATGAAGAAATGCAAAAG
GCTTTCATCTAATTGGCTGATGCTTATTGGGCTGCCGATTAATTCAACACTAATGTTAGA
GAATCTGTTAAGAAGGCACTTGTTAGAATTGAATATTCAAGTGAAAATATTGCAGGTGTT
ATGTTACCAAACTTAAATATTAGAGAAAACATAAAGGACAATGAAGATACTGAGGGTAAT
ATGGGTTTGCTTGGTCTTGATAAGGGTGGTTTCTCTATTCAAAAAGCTAAGGAAAGATTC
AAAGAAGCTCTCTACCTTCTTGTCAAAGTTGCTTCCCTTTAAACATCTTTCATAACTTTA
GATGAAGTTATTAAGGTAACAAACAGAAGAGTCAATGCCTTAGAACACGTCGTTATTCCA
AGATTTATGGAAGTTTAAGCTTATATTAATTAAGAACTTGACGAAATGTCAAGAGAAGAT
TTCTTCAGACTTAAGAAGGTGTTGGATTTCAAGAGAAAGGTTATTGCTGAAGAAGAAAAA
GAAACTGCAGCTAAAGAAGCTGAACTCCGTGCTAAGGGTGTTAAGAACATTGGTGGTGAT
CTCCTTAACGAAGAAGCTGATGAGGATATAGTTGTTTGA


>TTHERM_00821870(protein)
MSQQITPSRMTLAIYKAKTVSAKKGHELLKKKCDALKTKFRAIMIALLENKLKMDEEMQK
AFIQLADAYWAADQFNTNVRESVKKALVRIEYSSENIAGVMLPNLNIRENIKDNEDTEGN
MGLLGLDKGGFSIQKAKERFKEALYLLVKVASLQTSFITLDEVIKVTNRRVNALEHVVIP
RFMEVQAYINQELDEMSREDFFRLKKVLDFKRKVIAEEEKETAAKEAELRAKGVKNIGGD
LLNEEADEDIVV


>TTHERM_00821870(gene)
ATGTCACAATAAATTACACCTAGTAGAATGTAGCAACCAACATTTATTCAATTATTGATA
AATAAATATCTTTCAATTAGCTCAAAATTAGTAAAATAAGTTGGCATATTAAAATAAAAA
GCATTTTTTTAACGAAATAGATGCTATTTATTCATATCAATTAATCATTTCGCAGGATTT
TTAATTATCCATTTTAATGATCTTCAACTGTTTTCTTAATTTTGAGCCAAAAAAGATATT
TTTTTGTGGGAAAAAGCTTAAAAAAGATTTTATTATCAAAAAGGACTCTTGCTATATATA
AAGCAAAGACAGTCTCTGCCAAGAAAGGTCACGAATTGCTTAAAAAGAAATGTGATGCTT
TGAAGACCAAGTTCAGAGCTATTATGATTGCTCTTTTGGAAAATAAGTTGAAGATGGATG
AAGAAATGCAAAAGGCTTTCATCTAATTGGCTGATGCTTATTGGGCTGCCGATTAATTCA
AGTAAGATTCTAAATTTATTTATTTTTTATGATAAAATATAAACTTCTTTTGATCCAACA
AAATTGGATATCATAATTTACTTAAAAAATAGCACTAATGTTAGAGAATCTGTTAAGAAG
GCACTTGTTAGAATTGAATATTCAAGTGAAAATATTGCAGGTGTTATGTTACCAAACTTA
AATATTAGAGAAAACATAAAGGACAATGAAGATACTGGTAAAAATTTCTAAAGCATTAAC
CATATTTTGGTTATTTTTATTAAGCCAAATTAGACAATTAAATAAATCAAGAAAAAGCTT
ATTTAGGATATTTCCAAAAAATCTAATTATTTTGTTTACTTATAAATATTAGAGGGTAAT
ATGGGTTTGCTTGGTCTTGATAAGGGTGGTTTCTCTATTCAAAAAGCTAAGGAAAGATTC
AAAGAAGCTCTCTACCTTCTTGTCAAAGTTGCTTCCCTTTAAGTAATTTAGAGTTAAAAT
TTGTATGACAAAAAAGAAAAATATTTTGTTTTTCTTTAAACAATTAAATAAAATTAATTT
TAAATTAAATAAATTAACTTATTTAATAAAATATACTAGACATCTTTCATAACTTTAGAT
GAAGTTATTAAGGTAACAAACAGAAGAGTCAATGCCTTAGAACACGTCGTTATTCCAAGA
TTTATGGAAGTTTAAGCTTATATTAATTAAGAACTTGACGAAATGTCAAGAGAAGATTTC
TTCAGGTAAAAAAATTAAAAAATTAATAATTAATTAACTAATTTTATAATAACTAGACTT
AAGAAGGTGTTGGATTTCAAGAGAAAGGTTATTGCTGAAGAAGAAAAAGAAACTGCAGCT
AAAGAAGCTGAACTCCGTGCTAAGGGTGTTAAGAACATTGGTGGTGATCTCCTTAACGAA
GAAGCTGATGAGGATATAGTTGTTTGA