Identifiers and Description

Gene Model Identifier

TTHERM_00047070

Standard Name

VMA7 (Vacuolar Membrane Atpase )

Aliases

PreTt11186 | 3.m01799 | 3824.m02945

Description

V-type ATPase, F subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178

Molecular Function

  • proton-transporting ATPase activity, rotational mechanism (IEA) | GO:0046961
  • proton-transporting ATP synthase activity, rotational mechanism (IEA) | GO:0046933

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00047070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01750.17.999607936310296e-81V-type ATPase, F subunit prote
in (126 aa)
OxytrichaContig18550.0.g554.001416569413617e-37ATP synthase (F/14-kDa) subuni
t
DictyBaseDDB_G02718827.002785992501305e-33vatF on chromosome: 2 position
942083 to 942818
WormBaseWBGene000069189.99723014177113e-33locus:vha-9 Probable V-type
proton ATPase subunit F stat
us:Confirmed UniProt:Q23680
protein_id:CAA88888.1
SGDYGR020C1.9993007828132465e-27VMA7 Subunit F of the eight-su
bunit V1 peripheral membrane d
omain of vacuolar H+-ATPase (V
-ATPase), an electrogenic prot
on pump found throughout the e
ndomembrane system; required f
or the V1 domain to assemble o
nto the vacuolar membrane
Stentor CoeruleusSteCoe_28566.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00047070(coding)
ATGTCAAAAAAAGCTATTTCAGGAGGTAACAAGCTCATCGCCGTTATTGGTGATTCTGAT
ACAGTAACAGGCTTTTTGTTGACTGGTATTGGTGACAGAAACTTAAAGGGTTAATCTAAT
TTCTTGGTTGTCCAACCTGACACAAAGGAAAAGTTAGTCGAAGATACTTTCAATGGTTTC
TTAAAGAATGGCGATATAGCAGTCATTTTAGTTAGTTAACATGTTGCTGAAAAATATTTA
AGAAGTATAATTAACTCTTATGAAGAGACTCTTCCTGCTATCCTTGAAATTCCTAGCAAA
GATAAGCCCTATGAACCTAAAAAAGATATTATTATGCAAAGAGCTAATAAGTTGCTTTAC
GGTAGTGAAATCGTATGA


>TTHERM_00047070(protein)
MSKKAISGGNKLIAVIGDSDTVTGFLLTGIGDRNLKGQSNFLVVQPDTKEKLVEDTFNGF
LKNGDIAVILVSQHVAEKYLRSIINSYEETLPAILEIPSKDKPYEPKKDIIMQRANKLLY
GSEIV


>TTHERM_00047070(gene)
ATGTCAAAAAAAGCTATTTCAGGAGGTAACAAGCTCATCGCCGTTATTGGTGATTCTGTA
AAAAATTGCTAAAATTTACTAAGATTTAAAAATTATAAATAAAATTATATATCTTAAAGA
GCTGCGAAAAATATTTCATAAAACAAAAAAGTTATTTTCATTATTAATTAATAATAAAAT
GAAATTGAAGATATCATTATTGAAAAAAATATTTTTAGAAGCTTAATGAATAACTTTTTG
TTTTTAGTTTCAATATAAAATGTAAATAAATAATATTATATTAATAATACCAAAAGGATA
CAGTAACAGGCTTTTTGTTGACTGGTATTGGTGACAGAAACTTAAAGGGTTAATCTAATT
TCTTGGTTGTCCAACCTGGTAAGAAATTCATTATACTATTTAGCTCAAACCTGAAATTTA
ATAAATTATTAAAAAATAAAATTTAATTAGACACAAAGGAAAAGTTAGTCGAAGATACTT
TCAATGGTTTCTTAAAGAATGGCGATATAGCAGTCATTTTAGTTAGTTAACATGTAAAAT
AAAAAATAATTTAAGTTTGCAATTCAAATGATCAAAAATAAGAAAATGAAATATGTTTAT
TTGTTAAATTGTTATATATGAGAAAATAAATGAACAAATAACTTTATTGATTAATAACAA
AAATTAAATTTAAAATGAATAAAACCTAAAAAATATTAAAAATATAGGTTGCTGAAAAAT
ATTTAAGAAGTATAATTAACTCTTATGAAGAGACTCTTCCTGCTATCCTTGAAATTCCTA
GCAAAGATAAGCCCTATGAACCTAAAAAAGTAGAAAATTTATAATTGAAAATAATTTTTG
TTAATAAAATAAAATATTGTTAATAAATAGGATATTATTATGCAAAGAGCTAATAAGTTG
CTTTACGGTAGTGAAATCGTATGA