Identifiers and Description

Gene Model Identifier

TTHERM_00433470

Standard Name

VMA6 (vacuolar ATP synthase)

Aliases

PreTt26490 | 48.m00253 | 3831.m01591

Description

vacuolar ATP synthase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.8%

TetraMine Data

TTHERM_00433470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04180.19.997093137033517e-262vacuolar ATP synthase (385 aa)
OxytrichaContig5208.0.g473.0002015969469427e-102ATP synthase (C/AC39) subunit
DictyBaseDDB_G02736579.999565105288807e-71vatD-2 on chromosome: 2 positi
on 3242326 to 3243798
WormBaseWBGene000162581.9994274381022833e-63locus:vha-16 status:Confirme
d UniProt:Q95YD5 protein_i
d:CCD66185.1
SGDYLR447C1.0003503620230312e-57VMA6 Subunit d of the five-sub
unit V0 integral membrane doma
in of vacuolar H+-ATPase (V-AT
Pase), an electrogenic proton
pump found in the endomembrane
system; stabilizes VO subunit
s; required for V1 domain asse
mbly on the vacuolar membrane
Stentor CoeruleusSteCoe_268508.408597124803643e-50

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00433470(coding)
ATGGATCTTACTGTTTTCGCAGTTAATGATGGATTTGCTGAGGCTATTCTTCGTGGCCTT
CGTGCTTCCTTCATTACCCAAGCATAATACACTTAAATGAAGACCAGCAACAATCTTCAA
GATCTTAAATCCCACTTGGAAGAAACTGACTACGCTAATTACTTGTAAAACGACGTCGTT
GAATTGACCATTCCCTTATTACGTTAAAAGTTAAAAAAGAAATTAGCTGATGAATTAGAA
TACATCCAAGCTTAGAGTGTTGGCAAGTTAAATGAATTCATTAATATGATGAAACACAGA
TACATGATTGATAATGTTGTTAACATGATCGAAGGTATCAAGAACAAGGTTCACAAAGAT
GATTTAATTGCTGCTGCTGATCCTTTGGGTTTCTTCCCTGAAATGACTTAAATCAGTGTC
TTTGATAAGGATGATTATTCTGAATTGTATTAAGAAGTTCTTATTGATACTCCTGTTGGT
CCTTACTTCATGAGATTCTTAGAATCATGCATGCACGGAGTCTCTGAAAACTGTGGCATG
AATGTTGTCCAAGAAATTTTCAAGGAAATGAGACCCGAACACATTAGAACCTCTCTCAAG
AAGATGTGGTTAGAAGATTTCCATGAGTATTGTGTTGAATAATTAAACTCAACAAGTGCT
GAAATTTTAGATGATTTATTGAAATTCGAAGCTGATATGAAATCTATCCAAGTAGTTTAT
AACACTATCTAACACACTGTTGCTAAGAGTTAAGAAGTCAGAAAGTAACTCACTCCTGCT
TTGGGTTACTTGTATCCAGATTGCCAAACTTCCTTGAAGAATGCCAGAAGTTTGGATGAA
ATCAAGGAAGCTATAAAGGGTTGCGAAAACTATGGCAATATCGTTAAGGATGCTCCTGAT
CCTTCAAGAAAGGAAGAATAAAACTTTGCTACTTCATTAGAAGATTTGATGTATGATGAA
GAAATCAAGAGATACTCTCTTGCATTTGATTAAGCTGCCCAATATGCAGTCTTCTATGCA
TACTTAAAACTTAAGGAATAAGAAATCAGAAATATTGTTTGGTTAGCTGAAATGATTACT
CGTAATTTACCTAAAAACTCTCCTGGATGGAAAAAAATTGTTGTTCCTTTTGACAGTTTA
CTTAACATTAACTGA


>TTHERM_00433470(protein)
MDLTVFAVNDGFAEAILRGLRASFITQAQYTQMKTSNNLQDLKSHLEETDYANYLQNDVV
ELTIPLLRQKLKKKLADELEYIQAQSVGKLNEFINMMKHRYMIDNVVNMIEGIKNKVHKD
DLIAAADPLGFFPEMTQISVFDKDDYSELYQEVLIDTPVGPYFMRFLESCMHGVSENCGM
NVVQEIFKEMRPEHIRTSLKKMWLEDFHEYCVEQLNSTSAEILDDLLKFEADMKSIQVVY
NTIQHTVAKSQEVRKQLTPALGYLYPDCQTSLKNARSLDEIKEAIKGCENYGNIVKDAPD
PSRKEEQNFATSLEDLMYDEEIKRYSLAFDQAAQYAVFYAYLKLKEQEIRNIVWLAEMIT
RNLPKNSPGWKKIVVPFDSLLNIN


>TTHERM_00433470(gene)
ATGGATCTTACTGTTTTCGCAGTTAATGATGGATTTGCTGAGGCTATTCTTCGTGGCCTT
CGTGCTTCCTTCATTACCCAAGCATAATACACTTAAATGAAGACCAGCAACAATCTTCAA
GATCTTAAATCCGTAATTTATCCATTTCAATTAAAGATTAAAGCACATATATTTAATTCT
AATCAAATCTATTGTTGATTTGATTTAGAAGTTTTTTTCATTTAAAATACTATTCGATTT
GTCGAAATGTTAGGTTGTTTTGTAAAATGCCACTCAAAAGCCAATAAAATTTAACAAATA
GTTTCACAAACCCTAAGAGAATTCAGCTTTAGTTTAAAATTTAGTTTTATATAAAATAGC
TAAAATATTATTTAATAATTTGTATTTTCAAGCCTTACAACAACATATTAAATGCTATGG
AATAGTTGGCTATTTGGCTGAATAAAGAGCCACATCAGCAAATAATGAAATTGTCATAAA
TTAAAATTATGCGTTATTATGAACAAGCTAAATTAGGTTAATCACTTAAAAAAGCTGACT
AGTTTTGAGTAAAAAAATATCATTTAGGGTGTTAAGAATACCATTAGCATTACAAAATAT
GCAGTGTAAACATAAGCATAAAAGAAAGAAATAAAAGTGAAAAGCTTAAATAAATCAAAC
CAATAAAATTGTAATATTAAATAGAACCACAAATAAGAGATAAAAAAATTGCTTATTTTT
AAAATTAAAAAAAACATAATATAAAATATAGTATTGAAATAGATTTGATTAAATACTTGG
CAAAAACAATTTAAGATAAATAAATAAAAAATAAATATTGGTTTACTTTGTCACATGATA
AATTAAATAAATCAAATAACAAACTTAAATTATTAAATTTCTTTTATTAATAATATATGT
AAATAATTAGCACTTGGAAGAAACTGACTACGCTAATTACTTGTAAAACGACGTCGTTGA
ATTGACCATTCCCTTATTACGTTAAAAGTTAAAAAAGAAATTAGCTGATGAATTAGAATA
CATCCAAGCTTAGAGTGTTGGCAAGTTAAATGAATTCATTAATATGATGAAACACAGATA
CATGATTGATAATGTTGTTAACATGATCGAAGGTATCAAGAACAAGGTAAATAAATATAT
TAATTTCAAAATCAATTTTTATCTACAAAAAAGCAATTTACAATTATTTAGATAATTAAT
TAAATTTTGATCAGTTTGTATTATTCTAGTTTAATGAATAAATTATTTAAAATATTTTAG
GTTCACAAAGATGATTTAATTGCTGCTGCTGATCCTTTGGGTTTCTTCCCTGAAATGACT
TAAATCAGTGTCTTTGATAAGGATGATTATTCTGAATTGTATTAAGAAGTTCTTATTGAT
ACTCCTGTTGGTCCTTACTTCATGAGATTCTTAGAATCATGCATGCACGGAGTCTCTGAA
AACTGTGGCATGAATGTTGTCCAAGAAATTTTCAAGGAAATGAGACCCGAACACATTAGA
ACCTCTCTCAAGAAGGTAAATAAATTTTTCATTTTTACAATTATCAGTCAGCTTTATTTA
CAATCATAAATATGCATCAAATAATAATTTAATAAATAAAATTTATTTTAGTTTAGTTAA
ATAAACTATTTATTTGTTTGTTAAAATTTAAACTATCTGAAGATTTTTAGAAAAATAAAC
ATGACTAACAAACTTTTAATTAATTGTTGAATGAAATTTAATAAATAAATAAAATTTATT
AATTAGATGTGGTTAGAAGATTTCCATGAGTATTGTGTTGAATAATTAAACTCAACAAGT
GCTGAAATTTTAGATGATTTATTGAAATTCGAAGCTGATATGAAATCTATCCAAGTAGTT
TATAACACTATCTAACACACTGTTGCTAAGAGTTAAGAAGTCAGAAAGTAACTCACTCCT
GCTTTGGGTTACTTGTATCCAGATTGCCAAACTTCCTTGAAGAATGCCAGAAGTTTGGAT
GAAATCAAGGAAGCTATAAAGGGTTGCGAAAACTATGGCAATATCGTTAAGGATGCTCCT
GATCCTTCAAGAAAGGAAGAATAAAACTTTGCTACTTCATTAGAAGATTTGATGTATGAT
GAAGAAATCAAGAGATACTCTCTTGCATTTGATTAAGCTGCCCAATATGCAGTCTTCTAT
GCATACTTAAAACTTAAGGAATAAGAAATCAGAAATATTGTTTGGTTAGCTGAAATGATT
ACTCGTAATTTACCTAAAAACTCTCCTGGATGGAAAAAAATTGTTGTTCCTTTTGACAGT
TTACTTAACATTAACTGA