Identifiers and Description

Gene Model Identifier

TTHERM_00105320

Standard Name

VMA5 (Vacuolar Membrane Atpase)

Aliases

PreTt23032 | 7.m00481

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.5%

TetraMine Data

TTHERM_00105320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00369.19.997093137033517e-262vacuolar ATP synthase subunit
C (404 aa)
OxytrichaContig12845.0.g804.0017993270483566e-44V-ATPase subunit C
WormBaseWBGene000069205.997865882830678e-40locus:vha-11 V-type proton A
TPase subunit C status:Confi
rmed UniProt:Q9XXU9 protei
n_id:CCD66967.1
DictyBaseDDB_G02844733.998693556225637e-29vatC on chromosome: 4 position
2149008 to 2151203
SGDYKL080W3.0000451088882257e-25VMA5 Subunit C of the eight-su
bunit V1 peripheral membrane d
omain of vacuolar H+-ATPase (V
-ATPase), an electrogenic prot
on pump found throughout the e
ndomembrane system; required f
or the V1 domain to assemble o
nto the vacuolar membrane
Stentor CoeruleusSteCoe_58764.248354255291589e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00105320(coding)
ATGGTTTACTTTTTGGTTGGTGCTGAAAATCTTTTTGGTGATAGTGATAAAACCTTTTCA
AGAATCACCACAGAATTAGGCAACTTGGCTACCATTAAGAATAGGATTGATGTTCAAATA
AGGGATTTCAAGTTGAGCAATGTTGATTAGTTAATTTCTTCCAATGAAGCTATGCTTAAA
ATGGAAACACACATTGAAAGTATCTTGAAGAAAATCGAAAGAACATATATGGATATTACT
GAATCTCAACACGCTGAATTCCAAGTTAATACTAGAAGTAGTTCTGTTTCCTTGAGTCAA
TATGTTCAAGATTTTAAGTGGGATAATAATATTTTCTCCAGAAGTTAACCTTTAATGGAA
TTGTTGAAGAGTTTCTAACAAAAAGCAACTACCATTGATAACGATATTCGTTAAAAGCAA
CAAGTTCTTTAAGAAGCCAAAAATAACTTGAACAGTGTCGCCCTCAAAGAAGGAAACTTA
TTGGTTAAGGATTTGAGTGATGTTTTTAGAAAAGAATATGTCAAGGAAAAGGATTTCATT
TATACTGAAAATTTAACTACTGTAGTAGCTATTGTTCCCAACAATGTTTTAGAACACTTT
TAATAACAATATGAATTGATGCACCACTGTGTTGTCCCTGGATCTGCCAAGTAATTTGAA
GGCATTTAAGACAAAGACTATACCGTTTGGAGAATCGTTATATTTAAATTAGACTATAAG
AATTTAAAGAAGATTTTATTAGAAGGCGAAAAGCTTGATGAAAATGGCAAGCGCCAAAAA
ACTCCTGTAGAAGAATTCATTTCTGCAAGCAGAGAAAAGCTAAAAGTCACTGTTAAGGAA
TTTTAATATAATGAAAACGACTGTGCTGAAAGAGAAAGACAAAGAACAGCCTTCTAGACT
CAAGCTAATAGTTAAAGCGGAAAATTAAGACAAACTTGTGAAAAGAGTTTTGGTAATCTT
TATGAAGTTTATATCCACCTTAAATTCCTTAGACTTGTTGTTGAAATAGCTGCCAAATTC
GGTTAGAAATCTAACAATACTACTTGTTTGATTCAACCTGCTCCAGGAAAAGAAAAATAA
GTCCAACAAAAGTTGTTAAAGCTTTTTGCAGACCGTGCTTAATTGGATGCTGGTATGTAC
GGTACTAAGGAAGAATTAGAAGATACTGAAGATTTCTTCCCTTATGCTTATGTTCCCATT
ACTGTCTGA


>TTHERM_00105320(protein)
MVYFLVGAENLFGDSDKTFSRITTELGNLATIKNRIDVQIRDFKLSNVDQLISSNEAMLK
METHIESILKKIERTYMDITESQHAEFQVNTRSSSVSLSQYVQDFKWDNNIFSRSQPLME
LLKSFQQKATTIDNDIRQKQQVLQEAKNNLNSVALKEGNLLVKDLSDVFRKEYVKEKDFI
YTENLTTVVAIVPNNVLEHFQQQYELMHHCVVPGSAKQFEGIQDKDYTVWRIVIFKLDYK
NLKKILLEGEKLDENGKRQKTPVEEFISASREKLKVTVKEFQYNENDCAERERQRTAFQT
QANSQSGKLRQTCEKSFGNLYEVYIHLKFLRLVVEIAAKFGQKSNNTTCLIQPAPGKEKQ
VQQKLLKLFADRAQLDAGMYGTKEELEDTEDFFPYAYVPITV


>TTHERM_00105320(gene)
ATGGTTTACTTTTTGGTTGGTGCTGAAAATCTTTTTGGTGATAGTGATAAAACCTTTTCA
AGAATCACCACAGAATTAGGCAACTTGGCTACCATTAAGAATAGGATTGATGTAAAGTCT
AAACATTAAAAAGAAATTAGTTTTAATTTAGCGAATAGTTCCATCATCATACAATAAATT
AATAAATATAAGAAAGAGAGGTTCATTTTTAATTTATCATGCTTTTGAAAGTTAGTTTCA
ACAAGCAAAATATGAATTTTAACATAATTCAGCATTTTATTAATTAGCAAATTTATTTTA
CAAAGCAAAGTTAAGAGTAGTGACACAGCAATATTATTATTAAAAAATATAATGCAGAAC
AATTAAAAAATATAATTTTTTGAAGCAAATTTATTTAAGTGAAATTTAAAAGAGCAATTT
TAAAGGGAACTGCTAAAAATAAAACCCTGCAGTCAAGCGATTTATAAATTAAATGATTGT
TCAAATATATTAAATAGGTTCAAATAAGGGATTTCAAGTTGAGCAATGTTGATTAGTTAA
TTTCTTCCAATGAAGCTATGCTTAAAATGGAAACACACATTGAAAGTATCTTGAAGAAAA
TCGAAAGAACATATATGGATATTACTGAATCTCAACACGCTGAATTCCAAGTTAATACTA
GAAGTAGTTCTGGTAATTAATCACTTTTATAAATGAATTTGATTTTGCTAAAACAAGGAA
GAAAAATAATAAAAAGATAAAAAAATAAGTCAAAATAGCTAAAGAGAAATATATTAACTA
TTCAATCAATTATAATTCTTAATGGATTTTTGATAGAAATTATTTATAAATTATTAAATA
AGTCAATTTTGATGAAATTAAAGAGATATCAATATCTCTCGAGCATATTTTATATTTTAT
TTTTTTAATTATAAAATAAATAGTTTCCTTGAGTCAATATGTTCAAGATTTTAAGTGGGA
TAATAATATTTTCTCCAGAAGTTAACCTTTAATGGAATTGTTGAAGAGTTTCTAACAAGT
AAAAAATAATTTGTTTTATTGTATAAACTTTATTTATTTTCAAGTTAAAAATGCAAATTA
TTCAAGGTAGAAATTTGCAACAACAAAAAACTTATCTATTTTTAAATAAAATAATGAAAA
ATTTGAACTTTTATAAGTAATTTTTTATCTTAAAAAACTTAGAAAGCAACTACCATTGAT
AACGATATTCGTTAAAAGCAACAAGTTCTTTAAGAAGCCAAAAATAACTTGAACAGTGTC
GCCCTCAAAGAGTAAAAAGCCCTTTTTAAAAAAATAATCAAACAATATCTAAATTTAAAT
AAATAAATAATTAAAGAGGAAACTTATTGGTTAAGGATTTGAGTGATGTTTTTAGAAAAG
AATATGTCAAGGAAAAGGATTTCATTTATACTGAAAATTTAACTACTGTAGTAGCTATTG
TTCCCAAGTAAAGCAACACAAATTTTAGCAAATATTCATTAAATTTAATAAAAATAGCAA
TGTTTTAGAACACTTTTAATAACAATATGAATTGATGCACCACTGTGTTGTCCCTGGATC
TGCCAAGTAATTTATATATAAATAATCATATAAATTAATAGATAAACTTCATTACATTCT
TTCTTTTCTATTTTTACTTTAAATGATATTATCTTCCTTTGCATAAGGCAATTTTATTTA
ACAAAAATGGTTGATTTGTTCATTTATTATTTTAAGAAAATAAGCTTAGAAACTCTAAAA
TATTTTTTATAATAAGTGTTTATGTTTTTTTGAGTTTTTATTTTTTAATTTTATCTTTTT
AAATGTAAATTTCACAAAGATAATAAATATTTGAAAATGTTTTTTATTTATTTTATAATC
AATCAATTGAATTGACTTAATATTTAATTAATAAATAGGTAATTTGAAGGCATTTAAGAC
AAAGACTATACCGTTTGGAGAATCGTTATATTTAAATTAGACTATAAGAATTTAAAGAAG
ATTTTATTAGAAGGCGAAAAGCTTGATGAAAATGGCAAGCGCCAAAAAACTCCTGTAGAA
GAATTCATTTCTGCAAGCAGAGAAAAGCTAAAAGTCACTGTTAAGGAATTTTAATATAAT
GAAAACGACTGTGCTGAAAGAGAAAGACAAAGAACAGCCTTCTAGACTCAAGCTAATAGT
TAAAGCGTAATTTTACATAATTAAATTATTTATCCTTATAATAAATTATATTTTTTTTTT
AACTAAAAAGGGAAAATTAAGACAAACTTGTGAAAAGAGTTTTGGTAATCTTTATGAAGT
TTATATCCACCTTAAAGTAAATAAATAAATTGAATCATATCAAATTGCTTTAATAATTAA
TTTTAATAGTTCCTTAGACTTGTTGTTGAAATAGCTGCCAAATTCGGTTAGAAATCTAAC
AATACTACTTGTTTGATTCAACCTGCTCCAGGAAAAGAAAAATAAGTCCAACAAAAGTTG
TTAAAGCTTTTTGCAGACCGTGCTTAATTGGGTATAAATATTTATTTTTTTAATTCTGAA
TATTTTAATTAATTTCATTTAAACTAGATGCTGGTATGTACGGTACTAAGGAAGAATTAG
AAGATACTGAAGATTTCTTCCCTTATGCTTATGTTCCCATTACTGTCTGA