Identifiers and Description

Gene Model Identifier

TTHERM_00193660

Standard Name

VMA4 (Vacuolar Membrane Atpase)

Aliases

PreTt06649 | 16.m00305

Description

vacuolar ATP synthase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178

Molecular Function

  • proton-transporting ATPase activity, rotational mechanism (IEA) | GO:0046961

Biological Process

Domains

  • ( PF01991 ) ATP synthase (E/31 kDa) subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00193660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03646.16.001368665888701e-135vacuolar ATP synthase (230 aa)
OxytrichaContig16360.0.g42.999884853455273e-42ATP synthase (E/31 kDa) subuni
t
WormBaseWBGene000069176.001249495680822e-29locus:vha-8 status:Confirmed
UniProt:Q95X44 protein_id
:CCD65002.1
SGDYOR332W1.9993007828132465e-27VMA4 Subunit E of the eight-su
bunit V1 peripheral membrane d
omain of the vacuolar H+-ATPas
e (V-ATPase), an electrogenic
proton pump found throughout t
he endomembrane system; requir
ed for the V1 domain to assemb
le onto the vacuolar membrane
DictyBaseDDB_G02757013.001290106883431e-24vatE on chromosome: 2 position
5679309 to 5680331
Stentor CoeruleusSteCoe_219510.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28087716: Cheng CY, Young JM, Lin CG, Chao JL, Malik HS, Yao MC (2016) The piggyBac transposon-derived genes TPB1 and TPB6 mediate essential transposon-like excision during the developmental rearrangement of key genes in Tetrahymena thermophila. Genes & development 30(24):2724-2736

Sequences

>TTHERM_00193660(coding)
ATGGCAGATTTTATTAATAAACCTCAAGAAAACGTTTAGAAGATCGTTGAAGCCATCAAA
TCTGAAGCAGAAGAGAAGGCTGAACAAATTAAAAAGAATGCTGAAGAATAATTTAAGATT
CAAAAAAATAATATTGTCAATACTGAAAAGGATAAAATCATTGAAGAATATAAAAAGAGA
TTAGAAAAGCTCATAGTTGACAGAAGAATTCAACGTTCTGCCAAAATCAATGAATAGAGA
TTAGAAAAAATGAAAGCTCGTTTTGACTTTATTGAAAAGCTAAAGGGTGAAATTTCTAAT
AAAATCGTTTAATCCGTTTCAGACCCTAATAAATATAAAAATGTCTTCAAGCAACTTATA
ATCTAGGCCTTGATCAAGTTGATGGAACCTAAGGTTGAGTTAAAAGTAATGAAGAAAGAT
TTGTAGCTTGCTCGTGAAGTAAAGACAGAATGTGAAAATGAATTCAAGGCAATTGCTAAG
AGAGAATGTAATAGAGACTTTAACTGTACTATTATTATAAATGAATACCACTCTCTTGAA
GAAGAAAATCCTAAAGTTATTGGAGGTATTGTTCTCACTTGCGATGGTGGTAGAATTTAG
GTAAACAACACTTTAAATGCAAGAGTTGATCTTGCTTTCTAAGAATTCCTTCCTGACATC
AGAAGAATTCTTTTCCCTTCTATGAAATGA


>TTHERM_00193660(protein)
MADFINKPQENVQKIVEAIKSEAEEKAEQIKKNAEEQFKIQKNNIVNTEKDKIIEEYKKR
LEKLIVDRRIQRSAKINEQRLEKMKARFDFIEKLKGEISNKIVQSVSDPNKYKNVFKQLI
IQALIKLMEPKVELKVMKKDLQLAREVKTECENEFKAIAKRECNRDFNCTIIINEYHSLE
EENPKVIGGIVLTCDGGRIQVNNTLNARVDLAFQEFLPDIRRILFPSMK


>TTHERM_00193660(gene)
ATGGCAGATTTTATTAATAAACCTCAAGAAAACGTTTAGAAGATCGTTGAAGCCATCAAA
TCTGAAGCAGAAGAGAAGGCTGAACAAATTAAAAAGAATGCTGAAGAATAATTTAAGATT
CAAAAAAATAATATTGTCAATACTGAAAAGGATAAAATCATTGAAGAATATAAAAAGAGA
TTAGAAAAGCTCATAGTTGACAGAAGAATGTAATAATTTTATTGAAAAAGAATTGAAAAT
AATTATATTTTTAAGCAGTAAATTTAACAATTAAGCACATTTATTACTAAAAAAATCTAA
AATTATTTTCAAATATCTTAAAATAGTCAACGTTCTGCCAAAATCAATGAATAGAGATTA
GAAAAAATGAAAGCTCGTTTTGACTTTATTGAAAAGCTAAAGGGTGAAATTTCTAATAAA
ATCGTTTAATCCGTTTCAGACCCTAATAAATATAAAAATGTCTTCAAGCAACTTATAATC
TAGGTAATCCATTCAGCTAATATCCTTCATGTTTTAACTAAAAAATATAATTGCATTTGA
AATAAAATAATCAAATGATAAATATAGCAGCAGATAAAATAGTAATCCTATAATTTAGAT
TAGCATTAACAAAGACCAATAAGGTTGTTCAAAAAATATTAAAATGTTAGCATTGAAATT
TAGGTTAAAAATTTAGCATAATTGAATAAAAAATAAAATGATTCTATGGCAAATATTATA
TATCGAAATAAATATCAAACTTTGCTAAACACAAGATATATTAATTACTGCTTTTAATTA
AGTTATTAGCAATAAAAATCGTCATAGTTAGTGCATAAAAGGATTCAACAAATGCAAGTG
AATCAAATATTTAAGATCGATTTTTATAGTGATAAAAAAGTAGAATTATATAAATTTTTA
TTGTATTATTAGGCCTTGATCAAGTTGATGGAACCTAAGGTTGAGTTAAAAGTAATGAAG
AAAGATTTGTAGCTTGCTCGTGAAGTAAAGACAGAATGTGAAAATGAATTCAAGGCAATT
GCTAAGAGAGAATGTAATAGAGACTTTAACTGTACTATTATTATAAATGAATACCACTCT
CTTGAAGAAGAAAATCCTAAAGTGTAAACAAATTCATCCAAAGCATTTACTTTATCAATA
TTATTACTATTATTTATTTAGTATTGGAGGTATTGTTCTCACTTGCGATGGTGGTAGAAT
TTAGGTAAACAACACTTTAAATGCAAGAGTTGATCTTGCTTTCTAAGAATTCCTTCCTGA
CATCAGAAGAATTCTTTTCCCTTCTATGAAATGA