Identifiers and Description

Gene Model Identifier

TTHERM_00529860

Standard Name

VMA2 (Vacuolar Membrane Atpase)

Aliases

PreTt04655 | 67.m00170 | 3684.m00040

Description

V-type ATPase, B subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178
  • proton-transporting two-sector ATPase complex (IEA) | GO:0016469

Molecular Function

  • proton-transporting ATP synthase activity, rotational mechanism (IEA) | GO:0046933
  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820
  • proton-transporting ATPase activity, rotational mechanism (IEA) | GO:0046961

Biological Process

Domains

  • ( TIGR01031 ) ribosomal protein L32
  • ( TIGR01026 ) ATPase FliI/YscN family
  • ( PF00306 ) ATP synthase ab C terminal
  • ( TIGR01040 ) V-type ATPase, B subunit
  • ( TIGR01042 ) V-type ATPase, A subunit
  • ( TIGR01039 ) ATP synthase F1, beta subunit
  • ( TIGR00962 ) ATP synthase F1, alpha subunit
  • ( TIGR01041 ) ATP synthase archaeal, B subunit
  • ( TIGR01043 ) ATP synthase archaeal, A subunit
  • ( TIGR02545 ) flagellar protein export ATPase FliI
  • ( TIGR03305 ) alternate F1F0 ATPase, F1 subunit
  • ( TIGR03324 ) alternate F1F0 ATPase, F1 subunit
  • ( PF02874 ) ATP synthase alpha/beta family, beta-barrel
  • ( PF00006 ) ATP synthase alpha/beta family, nucleotide-binding
  • ( TIGR02546 ) type III secretion apparatus H+-transporting

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00529860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_30750
WormBaseWBGene000069219.997093137033517e-262locus:vha-12 Probable V-type
proton ATPase subunit B sta
tus:Confirmed UniProt:Q19626
protein_id:CCD69755.1
Tetrahymena borealisEI9_13666.19.997093137033517e-262V-type ATPase, B subunit prote
in (498 aa)
DictyBaseDDB_G02774019.997093137033517e-262vatB on chromosome: 2 position
8008207 to 8010029
OxytrichaContig908.1.g939.997093137033517e-262ATP synthase alpha/beta family
, nucleotide-binding domain
SGDYBR127C9.997093137033517e-262VMA2 Subunit B of the eight-su
bunit V1 peripheral membrane d
omain of the vacuolar H+-ATPas
e (V-ATPase), an electrogenic
proton pump found throughout t
he endomembrane system; contai
ns nucleotide binding sites; a
lso detected in the cytoplasm

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00529860(coding)
ATGTCTTCTGATCCTATAGCTGCTAAGATTCACGCAGCCGCAGCATCTAGAGATTATAAT
GTTGCTCCTCGTGCTGATTACAGAACAGTTTGCAAAGTCGATGGTCCTTTGGTTATCCTC
GATAATGTCAAATTCCCCAAGTTTGCTGAAATCGTTAACGTTTGCTTAGCCGATGGTACA
ATCCGTAAAGGTTAGGTTCTCGAAATCAGTGGTAAAAAGGCCGTCGTTTAGATCTTTGAA
GGTACTGATGGTATCGATAGTTTATATACTCACTGTGAATTCACTGGTGAAACTTTATAA
ATGCCCATTGCCGAAGAAATGTTAGGTAGAGTCTTCAATGGTTCTGGTACTCCTATTGAC
AAGGGTCCACCTGTTTTGGCTGAAAAATTCTAAAGTATTAATGGTCAACCCATTAATCCT
TACTCCAGAGTTTATCCCAAGGAAATGATTCAAACTGGTATTTCTGCTATCGATTGTATG
ACTTCTATTGCTAGAGGTTAAAAGATTCCTCTTTTCTCTGCTAACGGTCTTCCCCATAAT
GAAATTGGTGCTTAAATCGTGCGTTAAGCTTCTTTGGTTAAGGGTAAGGATGTTTTAGAT
CACTCCGAAGAAAACTTCGCCGTCGTTTTCGGTGCTATGGGTGTTAATATGGAAGTCGCT
CGTTTCTTCAGATAAGATTTCGAATCTAACGGTTCCATGGAAAAGGTTATTCTTTTCCTT
AATCTTGCTAATGATCCCACTATCGAACGTATCATTACTCCTCGTCTTTCTTTGACCGCT
GCCGAATATTTAGCTTACGAAAGAGAAATGCACGTCTTGGTTATCTTAACTGATATGTCA
TAATATGCTGATTCTTTGAGAGAAGTTTCAGCTGCCAGAGAAGAAGTCCCTGGTAGAAGA
TCTTATCCTGGTTATTTATATACTGATTTATCAACAATCTACGAAAGAGCCGGTAGAGTC
GAAGGTGTTAATGGTTCCATCACTTAAATTCCCATTCTTACCATGCCTTCTGATGATATT
ACCCATCCTATTCCCGATTTGACTGGTTATATTACTGAAGGTTAAATCTTCATTGATCGT
TAATTACATAATAAGTAAATTTATCCTCCCATCAATGTCTTACCTTCTCTTTCTCGTCTC
ATGAAGTCTGCTATTGGTATTGATGATCACGGTAAGGTCATGACCAGAGTTGATCACCCT
GATGTCTCCAACGAACTCTATGCTGCTTATGCTATTGGTAAGGATACTGCTGCAATGAAG
GCTGTCGTCGGTGAAGAAGCTCTTAATGAAGAAGATCACCTTTATCTTGAATTCTTAAAG
AATTTCGAATCTAAATATATTTCTCAAGTAATAAATAAGATTAAATTAGAAAACAAATTT
TTTATATTTTTAATATAATTTAGGGTCAATACGAATCTAGAACTATCTTCTAAACCTTAA
ACAAAGCTTGGGAATTACTCAGAATTTTCCCTCCAGAGAAGCTAAAAAAGATTAAACAAT
CAACCAAGGATTTGTACTACGCTAAAAGGGGTGAAGAAGAAGATAACTGATTACTAATTT
TATATAAGTTTTTTAACGTTTATCATATCAGAGTATTAAATATAAATTTATTATACAGTA
ATTTTTAGTAAGCAAAGCAAGTAAGCAAGTATCTATCTATATCATAGTATTATTCATCCT
TTCAAATTCAACAAATTAAAAAGTTCATTCACTTGTTTATTTAGTTCATATTTTTTATGA


>TTHERM_00529860(protein)
MSSDPIAAKIHAAAASRDYNVAPRADYRTVCKVDGPLVILDNVKFPKFAEIVNVCLADGT
IRKGQVLEISGKKAVVQIFEGTDGIDSLYTHCEFTGETLQMPIAEEMLGRVFNGSGTPID
KGPPVLAEKFQSINGQPINPYSRVYPKEMIQTGISAIDCMTSIARGQKIPLFSANGLPHN
EIGAQIVRQASLVKGKDVLDHSEENFAVVFGAMGVNMEVARFFRQDFESNGSMEKVILFL
NLANDPTIERIITPRLSLTAAEYLAYEREMHVLVILTDMSQYADSLREVSAAREEVPGRR
SYPGYLYTDLSTIYERAGRVEGVNGSITQIPILTMPSDDITHPIPDLTGYITEGQIFIDR
QLHNKQIYPPINVLPSLSRLMKSAIGIDDHGKVMTRVDHPDVSNELYAAYAIGKDTAAMK
AVVGEEALNEEDHLYLEFLKNFESKYISQVINKIKLENKFFIFLIQFRVNTNLELSSKPQ
TKLGNYSEFSLQRSQKRLNNQPRICTTLKGVKKKITDYQFYISFLTFIISEYQIQIYYTV
IFSKQSKQASIYLYHSIIHPFKFNKLKSSFTCLFSSYFL


>TTHERM_00529860(gene)
ATGTCTTCTGATCCTATAGCTGCTAAGATTCACGCAGCCGCAGCATCTAGAGATTATAAT
GTTGCTCCTCGTGCTGATTACAGAACAGTTTGCAAAGTCGATGGTCCTTTGGTTATCCTC
GATAATGTCAAATTCCCCAAGTAAATCATATATCAATTTCAACAATTAATAAATACTACT
ATGCAAATAGAGATAATAAAATAGGTTCATTTTTCATTCTATGGAAATAATTTTTCATAT
TTTACATACAAAATCAAATTCCAATTTTTTGTTAATGATACTACTGTATCAATCCTAATA
AAAAATTATGAATATAATGGATGGCATTAGTTTCCCAAAGAAGTTCCAAATAGCATATAA
AAAAATGTTAAGAACATTAATTATTAGAGCAGCACAAATCAAATAAACAACTTTTTTCAA
AGCAAATAGTTGAATGCAAAAAATAAAAATTTAGTAATAGATAGATTCAGTATAAAGAGT
AGAACAGATAAAATATATAAAAATATAGATAGATAGTTAGATTGTTTTGCTTGATGGTGA
TTCAATCAACTTTATAGATTTAAGAATGAACTTATTTTTTAACTTTTAATGTAGCTTTTA
CTTATTTTAATTTTTGTATCAAAAAGGTTTGCTGAAATCGTTAACGTTTGCTTAGCCGAT
GGTACAATCCGTAAAGGTTAGGTTCTCGAAATCAGTGGTAAAAAGGCCGTCGTTTAGGTA
AATAGTATTTAAAAAGAAAGGCAACAAAAAGGATTACTAAAAAAGTTGCTTTGCCATAAA
AATAAATGCATTAAACTAATCATATTTTTAATAAAATTAAAGATCTTTGAAGGTACTGAT
GGTATCGATAGTTTATATACTCACTGTGAATTCACTGGTGAAACTTTATAAATGCCCATT
GCCGAAGAAATGTTAGGTAGAGTCTTCAATGGTTCTGGTACTCCTATTGACAAGGGTCCA
CCTGTTTTGGCTGAAAAATTCTAAAGTATTAATGGTCAACCCATTAATCCTTACTCCAGA
GTTTATCCCAAGGAAATGATTCAAACTGGTATTTCTGCTATCGATTGTATGACTTCTATT
GCTAGAGGTTAAAAGATTCCTCTTTTCTCTGCTAACGGTCTTCCCCATAATGAAATTGGT
GCTTAAATCGTGCGTTAAGCTTCTTTGGTTAAGGGTAAGGATGTTTTAGATCACTCCGAA
GAAAACTTCGCCGTCGTTTTCGGTGCTATGGGTGTTAATATGGAAGTCGCTCGTTTCTTC
AGATAAGATTTCGAATCTAACGGTTCCATGGAAAAGGTTATTCTTTTCCTTAATCTTGCT
AATGATCCCACTATCGAACGTATCATTACTCCTCGTCTTTCTTTGACCGCTGCCGAGTAA
TTAACATACAATAAATATATTAATCTAATTTTTAGAAATGACTTTAAAATAAGATACAAA
TAAACACACACACATATAAATTAATATAAGATTAAGTGCATAATTAATTATTTCTTTCTT
TCTTGATCTCCCTCCCAATCAAAATAGCTTAGCTTATTAAAAATTTAATAACTATCTTGT
CCTGTATATTTAATTAACACTTAATCTTTCAATAATTAAAACTTTATAATCTGCATTTTT
CTGCCTTTCTAAACTAAAATCAGGCAACTAACTACTAATAAAAAATAAATAAACAAAAAA
TAAATTAGTCAGAAGGATGGTTAAAATTTTTTATTTTTTAGATATTTTTTAATAAAAAAT
TAGCTTATTGATTATTATTTAAGATATGAATAAAAGGCAAATAGTGTTTATGAAAGAAAA
AGCAATATAAAAAATTTTAATTTAACATCGCACTTTTAAATAAAAATAAAAAATTATTTT
ATTGATAAAAATCTTTTGAAAATATCAATAATAATAAATTATTTAAAAATTAATAGATAT
TTAGCTTACGAAAGAGAAATGCACGTCTTGGTTATCTTAACTGATATGTCATAATATGCT
GATTCTTTGAGAGAAGTTTCAGCTGCCAGAGAAGAAGTCCCTGGTAGAAGATCTTATCCT
GGTTATTTATATACTGATTTATCAACAATCTACGAAAGAGCCGGTAGAGTCGAAGGTGTT
AATGGTTCCATCACTTAAATTCCCATTCTTACCATGCCTTCTGATGATATTACCCATCCT
ATTCCCGATTTGACTGGTTATATTACTGAAGGTTAAATCTTCATTGATCGTTAATTACAT
AATAAGTAAATTTATCCTCCCATCAATGTCTTACCTTCTCTTTCTCGTCTCATGAAGTCT
GCTATTGGTATTGATGATCACGGTAAGGTCATGACCAGAGTTGATCACCCTGATGTCTCC
AACGAACTCTATGCTGCTTATGCTATTGGTAAGGATACTGCTGCAATGAAGGCTGTCGTC
GGTGAAGAAGCTCTTAATGAAGAAGATCACCTTTATCTTGAATTCTTAAAGAATTTCGAA
TCTAAATATATTTCTCAAGTAATAAATAAGATTAAATTAGAAAACAAATTTTTTATATTT
TTAATATAATTTAGGGTCAATACGAATCTAGAACTATCTTCTAAACCTTAAACAAAGCTT
GGGAATTACTCAGAATTTTCCCTCCAGAGAAGCTAAAAAAGATTAAACAATCAACCAAGG
ATTTGTACTACGCTAAAAGGGGTGAAGAAGAAGATAACTGATTACTAATTTTATATAAGT
TTTTTAACGTTTATCATATCAGAGTATTAAATATAAATTTATTATACAGTAATTTTTAGT
AAGCAAAGCAAGTAAGCAAGTATCTATCTATATCATAGTATTATTCATCCTTTCAAATTC
AACAAATTAAAAAGTTCATTCACTTGTTTATTTAGTTCATATTTTTTATGA