Identifiers and Description

Gene Model Identifier

TTHERM_00218330

Standard Name

VMA16 (Vacuolar Membrane Atpase)

Aliases

PreTt22260 | 18.m00286 | 3701.m00046

Description

ATP synthase subunit C family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177

Molecular Function

  • hydrogen ion transmembrane transporter activity (IEA) | GO:0015078

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.7%

TetraMine Data

TTHERM_00218330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06605.17.997392158323398e-113ATP synthase subunit C family
protein (180 aa)
OxytrichaContig5607.0.g537.998077742349047e-67ATP synthase subunit C
DictyBaseDDB_G02741417.999866353200662e-52DDB_G0274141 on chromosome: 2
position 4917455 to 4918802
WormBaseWBGene000069133.998181939598921e-51locus:vha-4 status:Confirmed
UniProt:G5EDB8 protein_id
:CAA92686.1
SGDYHR026W2.0000236365077126e-43VMA16 Subunit c of the vacuola
r ATPase, which functions in a
cidification of the vacuole; o
ne of three proteolipid subuni
ts of the V0 domain
Stentor CoeruleusSteCoe_303563.975449735908647e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00218330(coding)
ATGGCTGATTACTAATTTTAAGATAATTGGAACGATTTATTCGCTTCCATTAGTGGTTAT
TCATGGGCTTACTTAGGTATTGGTTTAGCTCTTGGTACCTCCATTGCAGGTGCTGCCTGG
GGTATTTTCATTACTGGTGCTTCTCTTTTGGGTGCTTCAGTCAAGGCTCCAAGTATTAGA
TCTAAGAATTTGATCAGTATCATTTTCTGTGAAGCCGTTGCTATTTATGGTGTAATTATG
GCCATTATTATGTAAGGTAAAATGGCCAATTTTACAGGTGGTATTCCTAATGATAATTAA
ATATTCTTGATCCAATATTCAGGCTATGCTATTTTCTGGACTGGTATCTCTGTAGGTATC
TCTAACTTTGTTTGTGGTATTTGTGTCGGTATTACTGGTAGTGGTTGTGCTATTTCTCAT
GCTCAATAAGCTGAAACCTTCGTTAAAATTTTGGTTATTGAAATTTTTGGAAGCGCTCTC
GGTCTTTTCGGTGTTATTGTAGGTATTATCTAATGTGGTGATGTTTCTTTCCCTACAAAG
TGA


>TTHERM_00218330(protein)
MADYQFQDNWNDLFASISGYSWAYLGIGLALGTSIAGAAWGIFITGASLLGASVKAPSIR
SKNLISIIFCEAVAIYGVIMAIIMQGKMANFTGGIPNDNQIFLIQYSGYAIFWTGISVGI
SNFVCGICVGITGSGCAISHAQQAETFVKILVIEIFGSALGLFGVIVGIIQCGDVSFPTK


>TTHERM_00218330(gene)
ATGGCTGATTACTAATTTTAAGATAATTGGAACGATTTATTCGCTTCCATTAGTGGTTAT
TCATGGGCTTACTTAGGTATTGGTTTAGCTCTTGGTACCTCCATTGCAGGTGCTGCCTGG
TATGTGATTTCGTTTCTTAATAATTCGTTAGTTATTAAAACATCAAGCTAAAAACAAATA
GAAACATATATAAATGCACATTAAATTCTTTCAATCTGCATAAAAATAGCAATTAACAGA
GAAGAAAATGCTGTTATCATACAAAAGAGAATAAAATTAACATCTTTTTAGATATTTTAG
CTAAACAACATAAATAGCAGCAATAAAAATTTAAAAAATTTTATTTATATAAATTAGGGG
TATTTTCATTACTGGTGCTTCTCTTTTGGGTGCTTCAGTCAAGGCTCCAAGTATTAGATC
TAAGAATTTGATCAGGTATTTTAATTAAAATTGAAATGTTTATTTAGAAAGGCTTTTAGA
AAGGGTGAATGGCAGATAGCACTATTACAAATTTTAAATGTTGAGAAAAATTTTATTAAC
AATGTATAATTTAACAAAGATAAATAAATAAATAATATATGGATTGAGATATTGAATAGT
GATGTGCTTCAAATAGTAAGTGTATCGAACAAATTTTAGAAGTTATACATCAACACATAG
TTTTATTGAACTTCACAAATAAAGCAGTGTTTTGTCTAATGCACAAAAATTCATCAAATA
AAATAAAAATAATAAAATCTTTGCTAATAAAGAAGCTTGAAATTTTTAGATTTGCTTCCC
AATCACTTTTTTAAGCTTTTCATTATGAAAATATCTTTACAATTTCTGAATTGAAATATA
AAAAGTTTACTCTAAAAATTTATTAATCATTTATTTATTCAAAAAAGTATCATTTTCTGT
GAAGCCGTTGCTATTTATGGTGTAATTATGGCCATTATTATGTAAGGTAAAATGGCCAAT
TTTACAGGTGGTATTCCTAATGATAATTAAATATTCTTGATCCAATATTCAGGCTATGCT
ATTTTCTGGACTGGTATCTCTGTAGGTATCTCTAACTTTGTTTGTGGGTAAATAATTTAC
TATTAAAATTACTTTATAAATTGATTAACTTAGTTTTTAAAATTATTTTACACATTAACT
AAAACAACTAACTCAGATTCGAATTTAACAAATAAGCAAACAAAAATTAATTAATTTTTT
TTGACTAAAAGTCTTTAGCTTCAAAAGAGCTAAATAAAAAAAAAATTAATTAATTAATAT
TCGAGTTAAGGACACTCATTTTAAGTTGCTTAAAGCATCTATCTAAATTAAAATATTTAA
CATAGAGATTTATTTATTTTTTACTTGAAATCTCAATAATTAATTCTAAAATATTTTATT
AAAAAGTATTTGTGTCGGTATTACTGGTAGTGGTTGTGCTATTTCTCATGCTCAATAAGC
TGAAACCTTCGTTAAAATTTTGGTTATTGAAATTTTTGGAAGCGCTCTCGGTCTTTTCGG
TGTTATTGTAGGTATTATCTAATGTGGTGATGTTTCTTTCCCTACAAAGTGA