Identifiers and Description

Gene Model Identifier

TTHERM_00112470

Standard Name

VMA11 (Vacuolar Membrane Atpase)

Aliases

PreTt27061 | 8.m00321 | 3812.m02358

Description

V-type ATPase, C subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177

Molecular Function

  • hydrogen ion transmembrane transporter activity (IEA) | GO:0015078

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 37.6%

TetraMine Data

TTHERM_00112470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03968.17.001811683013561e-96V-type ATPase, C subunit prote
in (155 aa)
OxytrichaContig22002.0.g1044.99966753182923e-69ATP synthase subunit C
WormBaseWBGene000069125.001636743996964e-56locus:vha-3 V-type proton AT
Pase 16 kDa proteolipid subuni
t 2/3 status:Confirmed Uni
Prot:P34546 protein_id:CCD66
969.1
SGDYPL234C2.0008958828286524e-54VMA11 Vacuolar ATPase V0 domai
n subunit c, involved in proto
n transport activity; hydropho
bic integral membrane protein
(proteolipid) containing four
transmembrane segments; N and
C termini are in the vacuolar
lumen
DictyBaseDDB_G02743819.999142814001536e-47vatP on chromosome: 2 position
4920282 to 4921065
Stentor CoeruleusSteCoe_131661.3336148155022614e-34

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00112470(coding)
ATGGCTGACTAACCAAAATCAACTAGTGCTCCTTTCTTTGGATTTGCAGGTGTATCCCTT
GCCTTAGTTTTAGCAAATGTAGGTGCCGCTTACGGTACTGCTAAAGCAGGTTCAGGTATC
AGTAGTATTGGTGTCTGGAAACCTTCTATTATCATGAAATCCCTCATTCCTGTTGTCATG
GCTGGTATATTGGGTATTTATGGTATGATCGTTGCTGTCATTCTAATTCAAAAGATTAGT
AAGAGTAACTACACCGATTTCGACGGTTACGCTCACCTCGCTGCTGGTTTAGCTTGTGGT
TTGAGCTCTCTTGCTGCTGGTTATGCTATTGGTATTGTTGGTGATGCTGGTGTTAGAGCT
AATGCTTTATAAGATAGAATTTTTGTTGGTATGATTCTTATTCTCATTTTTGCTGAAGCC
TTGGGTCTTTATGGTTTAATTATTGCTTTGATCCTTTCTCAATGA


>TTHERM_00112470(protein)
MADQPKSTSAPFFGFAGVSLALVLANVGAAYGTAKAGSGISSIGVWKPSIIMKSLIPVVM
AGILGIYGMIVAVILIQKISKSNYTDFDGYAHLAAGLACGLSSLAAGYAIGIVGDAGVRA
NALQDRIFVGMILILIFAEALGLYGLIIALILSQ


>TTHERM_00112470(gene)
ATGGCTGACTAACCAAAATCAACTAGTGCTCCTTTCTTTGGATTTGCAGGTGTATCCCTT
GCCTTAGTTTTAGCAAGTAATTAATAAAATAATCAATTAGGAAAAATATAAAATAAATTT
TAATCATAAAGCAATTTTCATTATCAAATTTGAAGTGTTCTTCGAAAAATTAATAATAAG
CATTCTATTTTTAATATAATAAAAGATGTAGGTGCCGCTTACGGTACTGCTAAAGCAGGT
TCAGGTATCAGTAGTATTGGTGTCTGGAAACCTTCTATTATCATGAAATCCCTCATTCCT
GTTGTCATGGCTGGTATATTGGGTATTTATGGTATGATCGTTGCTGTCATTCTAATTCAA
AAGAGTAAAATTAAAATAATTCTTATATTCATAAAAAATCTAAGATGAGTTTTATGTGAA
AAAATCACCTAGGAAATATTATAAATAAAATAAAGGATAGTGAAATTGAAATAATATTTA
TTAAATGAGTAAGTTTGAAGAATATAAGTATATTAGCAAACAAAGTCAAGAAGACATAAT
TTATTTTTTAAATAATATTTTCTATTTTAATAGTATTTAAATATGCTCTCAATACACTTA
AACTCTGCTTAGTTATAATAAAAATTGAATAAATAATTTATTAAATCATTTTAATTAAAT
ATAAATTTAGTTAGTAAGAGTAACTACACCGATTTCGACGGTTACGCTCACCTCGCTGCT
GGTTTAGCTTGTGGTTTGAGCTCTCTTGTAAAAATTAATTTTTTATTGCTAACTTAAAAA
AGAAAGAATGAAATATTATCTAAACAAATGTTATTCAAAGAATATTTCTATTTAAAAGCT
TCTTATATTCAAAAATAGTAATAAGGTTTGTAGAAAAAGGGTTATTATTAATATTCAAAC
ATAGGATAAAATAGATGAAAAAAAGCCTTGTTTGCATCAATCAAGCTTTAGATAAAATAC
AATGGAATAGAAATTAATCTCCTCTAAAAAATAATTATAAAAGGAATTCATTTTTAAATA
TAGGAAAAATCTTAGAAAATAAATAAATTAATTAACATATTACAAATAAATGATAATATC
TCAAATTTAAAAATAGAACTTTTAGTATTTTGAATATAAGATAGCTTATAAATATTTTAT
TTAAATGCAAATAAATGAATAAATAAATAAATAATTGATTGATTTATTATTAGATAAATA
GATAATATTGCGTTTTTAAGCTTAGCTTGCTTAATTAGAATTCTTTTTAATTTTTTATAT
CTTATAAATAAATAGGCTGCTGGTTATGCTATTGGTATTGTTGGTGATGCTGGTGTTAGA
GCTAATGCTTTATAAGATAGAATTTTTGTTGGTATGATTCTTATTCTCATTTTTGCTGAA
GCCTTGGGTCTTTATGGTTTAATTATTGCTTTGATCCTTTCTCAATGA