Identifiers and Description

Gene Model Identifier

TTHERM_00052460

Standard Name

VMA10 (Vacuolar Membrane Atpase)

Aliases

PreTt11426 | 3.m01792 | 3824.m03181

Description

V-type ATPase, G subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • vacuolar proton-transporting V-type ATPase complex (IEA) | GO:0016471

Molecular Function

  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00052460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01523.11.999469658314961e-75V-type ATPase, G subunit prote
in (123 aa)
OxytrichaContig1313.1.g1000.0000000000000030004923591262316Vacuolar (H+)-ATPase G subunit
WormBaseWBGene000069190.00000005999527666938375locus:vha-10 Probable V-type
proton ATPase subunit G sta
tus:Confirmed UniProt:P91303
protein_id:CCD71327.1
SGDYHR039C0.00000019998969434520019-A VMA10 Subunit G of the eigh
t-subunit V1 peripheral membra
ne domain of the vacuolar H+-A
TPase (V-ATPase), an electroge
nic proton pump found througho
ut the endomembrane system; in
volved in vacuolar acidificati
on
DictyBaseDDB_G02779710.000000600201742947405vatG on chromosome: 3 position
80768 to 81314

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00052460(coding)
ATGTTGGTTGGGTTGATTATTGAGGTCTAAAGAAAATAAAAATATTAAATAAAAAGGAAA
GTAAAATAAATCATAAAAGATAAATAAAATCACAAATTATAATATAAATTACTTTATAGC
AACTCTTAAAGAAAAAGCAATAAAAAATATCTAAAGATGAGCAATTCTAACGCCGTTGAT
GATCTCATGAGAGCTGAAAAGGATGCCAATGAAATCATTAAATAAGCCTAAACCCAAAGA
GAAAAGAAGCTTAAGGAAGCTAGAACTGCTGCTGAATAAGAAGTTAACAAGTTCAGAGCT
GAATAAGAAGCTAAATTCGAAGAAGAAAAGAAGACTAAATACGGAAACGACACTGAAACC
GAAAAGCTTAGAAAAGAAACTGAATAAGAAATCAAAAAGATTGCTGACGATTATAATAGA
AATAAAGATGCTGTTATTAATATGCTTATCGACAGAATTTTAACCGTCAAGATTGAAATC
CCTGAAGTCGTTAAGGGTGATTTCAGCAAAATGAAATAAAAGTGA


>TTHERM_00052460(protein)
MLVGLIIEVQRKQKYQIKRKVKQIIKDKQNHKLQYKLLYSNSQRKSNKKYLKMSNSNAVD
DLMRAEKDANEIIKQAQTQREKKLKEARTAAEQEVNKFRAEQEAKFEEEKKTKYGNDTET
EKLRKETEQEIKKIADDYNRNKDAVINMLIDRILTVKIEIPEVVKGDFSKMKQK


>TTHERM_00052460(gene)
GTTATGTTGGTTGGGTTGATTATTGAGGTCTAAAGAAAATAAAAATATTAAATAAAAAGG
AAAGTAAAATAAATCATAAAAGATAAATAAAATCACAAATTATAATATAAATTACTTTAT
AGCAACTCTTAAAGAAAAAGCAATAAAAAATATCTAAAGATGAGCAATTCTAACGCCGTT
GATGATCTCATGAGAGCTGAAAAGGATGCCAATGAAATCATTAAATAAGCCTAAACCCAA
AGGTATTAAGTCATAAAAACGATAAAATAAATAAATAAGCTCTTTGTTGGCCTTGGCCAT
TTGTTTTTATAAATATTTGAATTATCAGTAAAAAATAGATGGCAGAAAACTTTATCATTT
ATATCAAGCAACTTATTAAGTTTATTTTTTAAAAATAAATAGAGAAAAGAAGCTTAAGGA
AGCTAGAACTGCTGCTGAATAAGAAGTTAACAAGTTCAGAGCTGAATAAGAAGCTAAATT
CGAAGAAGAAAAGAAGACTGTACATTATTTATATATTCATAATTCACTAATTTGACCATT
TGATGGATTATAATCCGATCATTCTTTCTTAGCAAAATGCCATTTCTACAAATAAAAAAA
ATAAATAAACAAGAATAATTATTTTATGATATTTTAATATGGCAAAAATTTTAACAGTTT
GGAAATTTAATAAATCTAATTAAAATATAAATTACCTTAAGCTGCGTCCTATTTCATATA
TCTAAACATATTTAATTTGTAAAATAAAGAAATACGGAAACGACACTGAAACCGAAAAGC
TTAGAAAAGAAACTGAATAAGAAATCAAAAAGATTGCTGACGATTATAATAGAAATAAAG
ATGCTGTTATTAATATGCTTATCGACAGAATTTTAACCGTCAAGATTGAAATCCCTGAAG
TCGTTAAGGGTGATTTCAGCAAAATGAAATAAAAGTGA