Identifiers and Description

Gene Model Identifier

TTHERM_00339640

Standard Name

VMA1 (Vacuolar Membrane Atpase)

Aliases

PreTt06105 | 34.m00342 | 3689.m00136

Description

V-type ATPase, A subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178
  • proton-transporting two-sector ATPase complex (IEA) | GO:0016469

Molecular Function

  • proton-transporting ATPase activity, rotational mechanism (IEA) | GO:0046961
  • proton-transporting ATP synthase activity, rotational mechanism (IEA) | GO:0046933
  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820

Biological Process

Domains

  • ( TIGR01026 ) ATPase FliI/YscN family
  • ( PF00306 ) ATP synthase ab C terminal
  • ( TIGR01040 ) V-type ATPase, B subunit
  • ( TIGR01042 ) V-type ATPase, A subunit
  • ( TIGR01039 ) ATP synthase F1, beta subunit
  • ( TIGR00962 ) ATP synthase F1, alpha subunit
  • ( TIGR01041 ) ATP synthase archaeal, B subunit
  • ( TIGR01043 ) ATP synthase archaeal, A subunit
  • ( TIGR00767 ) transcription termination factor Rho
  • ( TIGR02545 ) flagellar protein export ATPase FliI
  • ( TIGR03305 ) alternate F1F0 ATPase, F1 subunit
  • ( TIGR03324 ) alternate F1F0 ATPase, F1 subunit
  • ( PF02874 ) ATP synthase alpha/beta family, beta-barrel
  • ( PF00006 ) ATP synthase alpha/beta family, nucleotide-binding
  • ( TIGR02546 ) type III secretion apparatus H+-transporting

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00339640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_109990
WormBaseWBGene000130259.997093137033517e-262locus:vha-13 V-type proton A
TPase catalytic subunit A st
atus:Confirmed UniProt:Q9XW9
2 protein_id:CAA22076.1
Tetrahymena borealisEI9_15093.19.997093137033517e-262V-type ATPase, A subunit prote
in (618 aa)
DictyBaseDDB_G02871279.997093137033517e-262vatA on chromosome: 4 position
5370324 to 5372643
OxytrichaContig19301.0.g149.997093137033517e-262ATP synthase alpha/beta family
, nucleotide-binding domain
SGDYDL185W4.001709789838121e-126VMA1 Subunit A of the eight-su
bunit V1 peripheral membrane d
omain of the vacuolar H+-ATPas
e; protein precursor undergoes
self-catalyzed splicing to yi
eld the extein Tfp1p and the i
ntein Vde (PI-SceI), which is
a site-specific endonuclease

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00339640(coding)
ATGGCTTAAAGAAAAACTGCTTTAGAAGAAATTGCCGAAAAGGAATCCAACTTCGGTAAA
ATTTTCAAGGTCGCCGGTCCTCTGGTCGTTGCTGAACAAATGGTTGGTGCTAAGATGTAC
GAATTGGTTAAAGTCGGTTGGAATAAATTGGTCGGTGAAATTATCAAGCTCGATGGTGAC
ACTGCATCTATTCAATGTTACGAAGATACTTATGGTTTGACTGTTGGTGATCCAGTCATG
AGAACTAAAGAACCTCTTTCAGTCGAACTTGGTCCTGGTATTTTGAATGGTATTTTTGAC
GGTATCTAAAGACCTCTTGGTTCTATTGCTTAGGTTTCAGGTTCAGCTTTCATCCCTAGA
GGTGTTGATGTCCCTATTTTAGATGGAGATAAGTAATGGCATTTTATTCCTAGACCTGAT
ATTAAGGTTGGCTCTAAGCTTACTGGTGGTGATATCTTCGGTCACTGTCACGAAAACAAC
TTGTTCTGTAAGCACAACATTATGCTTCCTCCCAAGGGTAAGGGTCACGTCACTTACATT
GCTCCTGAAGGCTAATACACCATCCATGAAAAAGTTTTAGAACTCGAAATTGATGGCAAG
AAGACTTCTTACAAAATGTCTCACTTCTGGCCTGTCAGATAAGCTCGTCCCGTTTTAGAA
AGACTCTAAGGTAATGTTCCTCTTCTTACTGGTCAAAGAGTTTTGGATGCTCTTTTCCCT
TCAGTCTTGGGTGGTACTTGCGCTATTCCTGGTGCTTTTGGTTGCGGTAAAACTTGTATT
TCTTAAGCCTTATCTAAATACTCTAACTCCGAAGTCATCGTTTACGTCGGTTGTGGTGAA
AGAGGTAACGAAATGGCTGAAGTACTTACTGATTTCCCTGAATTGAAAACTGAAATTAAT
GGTAAGAAAGAATCTATTATGCAACGTACTTGTTTGGTCGCTAATACATCTAACATGCCT
GTCGCTGCCAGAGAAGCTTCTATTTACACTGGTATTACTCTTGCTGAATACTTCAGAGAT
ATGGGTTACAACGTTAGTATGATGGCTGACTCAACTTCTCGTTGGGCTGAAGCCTTGAGA
GAAATTTCTGGTCGTCTTGCTTAGATGCCTGCTGAATAAGGTTATCCTGCTTATCTTGCC
AATAAGCTTGCCTTCTTCTACGAAAGAGCTGGTCGTGTCAAATGTTAGGGTTCTCCCAAC
AGAGAAGGTTCTATTACAATTGTCGGTGCCGTCTCTCCTCCTGGTGGTGATTTCACTGAT
CCAGTTACAGTCTCTACTCTTGCTATCGTACAAGTTTTCTGGGGTCTCGATAAGAAATTA
GCTCAACGTAAACATTTCCCTTCAGTCGACTGGAACAAATCTACATCCAACTACGAAAGA
CAATTAGATCCTTACTTCAACAACTTCGATCCTGATTTCTCTAATTTACGTACTTCTATT
AAAAAAATCTTATAAGAAGAAAATGAATTGAATGAAATCGTCCAATTGGTCGGTAAGGAC
TCTCTTTCTGAAGATTAAAAGCTTACCTTAGAAGTCGCTAGAGTTATTAGAGAAGATTTC
TTACAATAAAACGCTTTCTCAGATTATGATTACATGTGTCCCTTAGAAAAGACTATTGGT
ATGATGAGAGGTATTTTCACTTACTACGACAATGCTAGAAGAACCATTGTTGAATCTTCT
GGTGAAACCAAGATTAACTGGAACGAAATTCTCTTCCAAACCAAGCCTCTCTTCCTCTAA
CTTACTGATATGAAGAGACTTGACCCTAAAAAACCTAAATAAGAAGTCAATCAATATTTC
AGTAAATACGTTGAAGATGTCAATCTTGCTTTCAGAAAAATCAATGACCGTTGA


>TTHERM_00339640(protein)
MAQRKTALEEIAEKESNFGKIFKVAGPLVVAEQMVGAKMYELVKVGWNKLVGEIIKLDGD
TASIQCYEDTYGLTVGDPVMRTKEPLSVELGPGILNGIFDGIQRPLGSIAQVSGSAFIPR
GVDVPILDGDKQWHFIPRPDIKVGSKLTGGDIFGHCHENNLFCKHNIMLPPKGKGHVTYI
APEGQYTIHEKVLELEIDGKKTSYKMSHFWPVRQARPVLERLQGNVPLLTGQRVLDALFP
SVLGGTCAIPGAFGCGKTCISQALSKYSNSEVIVYVGCGERGNEMAEVLTDFPELKTEIN
GKKESIMQRTCLVANTSNMPVAAREASIYTGITLAEYFRDMGYNVSMMADSTSRWAEALR
EISGRLAQMPAEQGYPAYLANKLAFFYERAGRVKCQGSPNREGSITIVGAVSPPGGDFTD
PVTVSTLAIVQVFWGLDKKLAQRKHFPSVDWNKSTSNYERQLDPYFNNFDPDFSNLRTSI
KKILQEENELNEIVQLVGKDSLSEDQKLTLEVARVIREDFLQQNAFSDYDYMCPLEKTIG
MMRGIFTYYDNARRTIVESSGETKINWNEILFQTKPLFLQLTDMKRLDPKKPKQEVNQYF
SKYVEDVNLAFRKINDR


>TTHERM_00339640(gene)
ATGGCTTAAAGAAAAACTGCTTTAGAAGAAATTGCCGAAAAGGAATCCAACTTCGGTAAA
ATTTTCAAGGTCGCCGGTCCTCGTAAGCTATTTTCTTTCAAGAAATATTATAGTAATAGG
GTTTAGGAGAGTGCAAAAATTAAGAAAGTAAAGTAGCAGTTGAGTGAGCAAATCTACACA
GGATGATTTTACCTAACATTGAATGCATTTATTTGTATTATACAATTTAGACTGCCAATC
CTAATTAGTGTCTAATGTTTCTTTCTTTTTTATGATATGCAGAATATGTTTGAAGACCAA
AATAGGATATGCTGATTAATATTTACATAATAGCATCTAAATCTAATTGATTACCACTCT
ACATAGTGCTTCAGTTCTTAATTTTGATTTGCTTCACAATTGCTCCTAAAAGAAAAATAA
AATCCTCTTCTAAATCCTTTAAATATTCCATTCGAAAACTTTTTATAAAAAATATATTAA
ATTTCATAATAATTTTATAAAATAGTGGTCGTTGCTGAACAAATGGTTGGTGCTAAGATG
TACGAATTGGTAAGAAATTGTTTAATTTAGATTTTAAGAATTAATTACTTTTAACCAAAA
TTACTCACTTTAATGTTAATCAAAAATGAAAGCATGCTAAATATTATTTTATATACAATT
ATAGGTTAAAGTCGGTTGGAATAAATTGGTCGGTGAAATTATCAAGCTCGATGGTGACAC
TGCATCTATTCAATGTTACGAAGATACTTGTAAGAAGAAGAAAAAATACTTTTCATCAGA
AAAGTGATATTAAATGAAATTAATTAATTAAATCTTAAATAAAAATAGATGGTTTGACTG
TTGGTGATCCAGTCATGAGAACTAAAGAACCTCTTTCAGTCGAACTTGGTCCTGGTAAAT
AAATTACAAATTCATTTATTATAATACCAACTTGATTTATTGAAGTATCAATTATCCAAA
ATAGACCAAAATATATAAAAATTAATTGATCCAATTACAATATGCGCATCCAATTATATA
AATAATTATCCAATTTAGATTAAAAAAAGACGATAAGCAATAAAATTAACCAATAAATAG
ACTTAAAAATAAATGAATCATTTATTTATTTTTCAATAAGCGATTGTTTTTTAGGAAATA
TTAAATAAATAGTAAGTCATTTTTTTATAGAGGACTTCAAAAAATATATTGGTTTTTTCT
GATTTGCAAATAATAAAATTTAAGGTTAGCAGCTAAGCTAAGATAAGCCAAATAGATTCA
ATTTTAATTATTAAAAAGATACACGCATTTTAATCTTGAAAAAGCAAATATTATATTGTG
CAAATTTGTTTATTTTATAAAAAATTAAGAAAATTAATAAATAAATAAATAAAAGTTGGG
TAGATTTTAAGATAGTGAATTAATAAATAAATTATTTAATAAACAAATTAGAAGGATTTT
GATTTGTTTGCGAAAACATCTAGAATAATTTACTATTTAATAATCATCAAGATATATTCT
ATACCTAGCTTTTCATTATTTTCTTTAAAAAATAAGACATTAGCACAAATAATGGATTGA
TTGATAATACAAACAACTTCAATTTCATTTTCCAAGCAAACAAAAATACTTTGTCATTCT
TTTTAATAATTTTTATATTTTTACAACAAAACAGGTATTTTGAATGGTATTTTTGACGGT
ATCTAAAGACCTCTTGGTTCTATTGCTTAGGTTTCAGGTTCAGCTTTCATCCCTAGAGGT
GTTGATGTCCCTATTTTAGATGGAGATAAGTAATGGCATTTTATTCCTAGACCTGATATT
AAGGTTGGCTCTAAGCTTACTGGTGGTGATATCTTCGGTCACTGTCACGAAAACAACTTG
TTCTGTAAGCACAACATTATGCTTCCTCCCAAGGGTAAGGGTCACGTCACTTACATTGCT
CCTGAAGGCTAATACACCATCCATGAAAAAGTTTTAGAACTCGAAATTGATGGCAAGAAG
ACTTCTTACAAAATGTCTCACTTCTGGCCTGTCAGATAAGCTCGTCCCGTTTTAGAAAGA
CTCTAAGGGTAACTTACCTTTTATTTATGAAATAAACTAAATTTAAATATTTTTTAATTT
AATTCTAAATAGTAATGTTCCTCTTCTTACTGGTCAAAGAGTTTTGGATGCTCTTTTCCC
TTCAGTCTTGGGTGGTACTTGCGCTATTCCTGGTGCTTTTGGTTGCGGTAAAACTTGTAT
TTCTTAAGCCTTATCTAAATACTCTAACTCCGAAGTCATCGTTTACGTCGGTTGTGGTGA
AAGAGGTAACGAAATGGCTGAAGTACTTACTGATTTCCCTGAATTGAAAACTGAAATTAA
TGGTAAGAAAGAATCTATTATGCAACGTACTTGTTTGGTCGCTAATACATCTAACATGCC
TGTCGCTGCCAGAGAAGCTTCTATTTACACTGGTATTACTCTTGCTGAATACTTCAGAGA
TATGGGTTACAACGTTAGTATGATGGCTGACTCAACTTCTCGTTGGGCTGAAGCCTTGAG
AGAAATTTCTGGTCGTCTTGCTTAGATGCCTGCTGAATAAGGTTATCCTGCTTATCTTGC
CAATAAGCTTGCCTTCTTCTACGAAAGAGCTGGTCGTGTCAAATGTTAGGGTTCTCCCAA
CAGAGAAGGTTCTATTACAATTGTCGGTGCCGTCTCTCCTCCTGGTGGTGATTTCACTGA
TCCAGTTACAGTCTCTACTCTTGCTATCGTACAAGTTTTCTGGGGTCTCGATAAGAAATT
AGCTCAACGTAAACATTTCCCTTCAGTCGACTGGAACAAATCTACATCCAACTACGAAAG
GTATTTATCATTTATTTATCTTTTATAACATAAATATTAATTGACTGAATCTTATTAAAA
ATAGACAATTAGATCCTTACTTCAACAACTTCGATCCTGATTTCTCTAATTTACGTACTT
CTATTAAAAAAATCTTATAAGAAGAAAATGAATTGAATGAAATCGTCCAATTGGTCGGTA
AGGACTCTCTTTCTGAAGATTAAAAGCTTACCTTAGAAGTCGCTAGAGTTATTAGAGAAG
ATTTCTTACAATAAAACGCTTTCTCAGATTATGATTACATGTGTCCCTTAGAAAAGACTA
TTGGTATGATGAGAGGTATTTTCACTTACTACGACAATGCTAGAAGAACCATTGTTGAAT
CTTCTGGTGAAACCAAGATTAACTGGAACGAAATTCTCTTCCAAACCAAGCCTCTCTTCC
TCTAACTTACTGATATGAAGAGACTTGTAATTTACTAATTCATTAATTAATTTAAAAATT
TTTTAATTTATTTAATTTAACTAATAAAATAGGACCCTAAAAAACCTAAATAAGAAGTCA
ATCAATATTTCAGTAAATACGTTGAAGATGTCAATCTTGCTTTCAGAAAAATCAATGACC
GTTGA