Identifiers and Description

Gene Model Identifier

TTHERM_00117590

Standard Name

VDAC4 (Voltage Dependent Anion selective Channel 4)

Aliases

PreTt27177 | 8.m00437 | 3812.m02469

Description

Eukaryotic mitochondrial membrane porin (Porin3 domain); involved in communication among organelles and trans-membrane transport

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.6%

TetraMine Data

TTHERM_00117590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03877.14.0000050475224054e-168hypothetical protein (309 aa)
OxytrichaContig10439.0.g720.0000004998288985444982Eukaryotic porin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000322

Sequences

>TTHERM_00117590(coding)
ATGGCTCAATCTTTAAAGCTTTAACCTTTAACCAGTCTTGGAACACCCAACAACGTTCTT
TCTGACGACTACGTTCACGGTACCTTCGAAACCTACAAGTTCAAGGCCAGCACCACCAAC
GGAGGTAAGGTTGACTACAAGGCTAAGGTTGCCACCGCTCAAAAGGATGGTAAGCTTGCT
GTCAAGGTCAGTGATGAAGGTAAAATCTAATTCCCCTTCCTCGACAAGTACACCTTCTAA
TTCTGTTAGAGAAGATCTGGTGATGTCAAGCTCCACTTCGACTTGGGTAACTACACCATT
TCCGGTAAATCATGGAACTTCTTCACTAACGTCAAGACCGATACCACCTTATCCAAGTTC
AATTTCAGATTAGGTACTAACTACTTTGGTAGCACTTGCGAATCTAACACCAGATTAGAA
TTAGTCCCTGGTGATGCTCCCGTCCTTACTCACAGAAACTACATCAAGAAGGGATCTATC
TACTACGGTGGTGTCTTCTCCCTTAACCTCTAAGCTTTAGCTTTAAAGAGATACGACGCT
CTCTTTGGTTACGTCAATGATAAGTATGAAGCTAACCTCAAGCACGAATCTGACAACAAG
GATACCAAGGATTTACAAGTTGGTACTCTTACTGCTACTGTTTCTTACTTCCACGATGCT
AACACCAAGCTTGCTCTTGAAGTCTAAAACAAGGGTCACAAGTTATAACCTACCTTCACC
GTTGGTGCTCAACGTAAGGTTAACAGCGACTTGACTGTTAAGGGTAAGGTCAACAACAAA
TTAGATTTATCTTTGGCCTCTAAGTACGCTCTTAACAGACAATTCACCCTCACTGCTGGT
CTCCAATTAGCCTTAAACGAAAAGAACATTGTTGATTTCAGCAAGTTCCCTCCCGTCCCC
TTCGGTTTACAATTAGAAACCAACTTTTGA


>TTHERM_00117590(protein)
MAQSLKLQPLTSLGTPNNVLSDDYVHGTFETYKFKASTTNGGKVDYKAKVATAQKDGKLA
VKVSDEGKIQFPFLDKYTFQFCQRRSGDVKLHFDLGNYTISGKSWNFFTNVKTDTTLSKF
NFRLGTNYFGSTCESNTRLELVPGDAPVLTHRNYIKKGSIYYGGVFSLNLQALALKRYDA
LFGYVNDKYEANLKHESDNKDTKDLQVGTLTATVSYFHDANTKLALEVQNKGHKLQPTFT
VGAQRKVNSDLTVKGKVNNKLDLSLASKYALNRQFTLTAGLQLALNEKNIVDFSKFPPVP
FGLQLETNF


>TTHERM_00117590(gene)
ATGGCTCAATCTTTAAAGCTTTAACCTTTAACCAGTCTTGGAACACCCAACAACGTTCTT
TCTGACGACTACGTTCACGGTACCTTCGAAACCTACAAGTTCAAGGCCAGCACCACCAAC
GGAGGTAAGGTTGACTACAAGGCTAAGGTTGCCACCGCTCAAAAGGATGGTAAGCTTGCT
GTCAAGGTCAGTGATGAAGGTAAAATCTAATTCCCCTTCCTCGACAAGTACACCTTCTAA
TTCTGTTAGAGAAGATCTGGTGATGTCAAGCTCCACTTCGACTTGGGTAACTACACCATT
TCCGGTAAATCATGGAACTTCTTCACTAACGTCAAGACCGATACCACCTTATCCAAGTTC
AATTTCAGATTAGGTACTAACTACTTTGGTAGCACTTGCGAATCTAACACCAGATTAGAA
TTAGTCCCTGGTGATGCTCCCGTCCTTACTCACAGAAACTACATCAAGAAGGGATCTATC
TACTACGGTGGTGTCTTCTCCCTTAACCTCTAAGCTTTAGCTTTAAAGAGATACGACGCT
CTCTTTGGTTACGTCAATGATAAGTATGAAGCTAACCTCAAGCACGAATCTGACAACAAG
GATACCAAGGATTTACAAGTAACTTTTATTTAAAAACAGCTATCTCAAATAGCATAAATA
TTCAATGAAATTAAGTAGAAAAGACATGTTTTTTTTATCAGGTTTTTAAATAATTTTAAA
TATTGCTTAGACATTTCAAACTTTCAAATAAGATATGACAAGAGATACTCATAAATAAAA
AAATATATTAAAAAATTATACACATAACCAATCTTCAATCTATTTTTTTTTGATAGCAAG
CAATAGAATTAATTATACAGTAAATATCTATGTTTGTTTGTTAATCAAACAATAAAGAAA
AAATAATTGAAATATCAGACAAACAGACAGACACAGTTAAGTAGGACTTTAAAAGCAAAT
TATGATAATCAAATCATTAAATTTATTTTAATAAATGAAATGTCAGTCGAAGCAGCATAA
ATATATGGTAAAATAAGAAGTCTATCCATAGGGGTATTTTTGACACTCATTTTTCAAAAT
TTTAAAACATTTTAAAATTTTGAAAAATGAGTGTCAAAAATACCCTATGGGATAGACTTC
TTATTTTACCATATATGCATAAACAGAGCTAAACAAATTTAATAAATATTAAAAGCTTAG
GATTAGAAAATTTTTTAAAAAGAAAAGCTAGTAAAATAAATTAATAAATAAATAAACAAA
AAACAGATTTTAAAATTCAAAAAATCTTAAATGACACAATAATCCTATTCACATCAATTC
CAATAAAAAAAATCACGTCACTTTTATCTCCTTAAATTTTTAAAATCTCTTAATAATTAA
TTATTCTTTTCGAAGTTTAATTTCATAAAAGTCATTCAGCTCTCATTGTATAAATAAATT
TAATTTAATAATATAGGTTGGTACTCTTACTGCTACTGTTTCTTACTTCCACGATGCTAA
CACCAAGCTTGCTCTTGAAGTCTAAAACAAGGGTCACAAGTTATAACCTACCTTCACCGT
TGGTGCTCAACGTAAGGTTAACAGCGACTTGACTGTTAAGGGTAAGGTCAACAACAAATT
AGATTTATCTTTGGCCTCTAAGTACGCTCTTAACAGACAATTCACCCTCACTGCTGGTCT
CCAATTAGCCTTAAACGAAAAGAACATTGTTGATTTCAGCAAGTTCCCTCCCGTCCCCTT
CGGTTTACAATTAGAAACCAACTTTTGA