Identifiers and Description

Gene Model Identifier

TTHERM_00117590

Standard Name

VDAC4 (Voltage Dependent Anion Selective Channel 4)

Aliases

PreTt27177 | 8.m00437 | 3812.m02469

Description

eukaryotic mitochondrial membrane porin (Porin3 domain)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00117590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03877.14.0000050475224054e-168hypothetical protein (309 aa)
OxytrichaContig10439.0.g720.0000004998288985444982Eukaryotic porin

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00117590(coding)
ATGGCTCAATCTTTAAAGCTTTAACCTTTAACCAGTCTTGGAACACCCAACAACGTTCTT
TCTGACGACTACGTTCACGGTACCTTCGAAACCTACAAGTTCAAGGCCAGCACCACCAAC
GGAGGTAAGGTTGACTACAAGGCTAAGGTTGCCACCGCTCAAAAGGATGGTAAGCTTGCT
GTCAAGGTCAGTGATGAAGGTAAAATCTAATTCCCCTTCCTCGACAAGTACACCTTCTAA
TTCTGTTAGAGAAGATCTGGTGATGTCAAGCTCCACTTCGACTTGGGTAACTACACCATT
TCCGGTAAATCATGGAACTTCTTCACTAACGTCAAGACCGATACCACCTTATCCAAGTTC
AATTTCAGATTAGGTACTAACTACTTTGGTAGCACTTGCGAATCTAACACCAGATTAGAA
TTAGTCCCTGGTGATGCTCCCGTCCTTACTCACAGAAACTACATCAAGAAGGGATCTATC
TACTACGGTGGTGTCTTCTCCCTTAACCTCTAAGCTTTAGCTTTAAAGAGATACGACGCT
CTCTTTGGTTACGTCAATGATAAGTATGAAGCTAACCTCAAGCACGAATCTGACAACAAG
GATACCAAGGATTTACAAGTTGGTACTCTTACTGCTACTGTTTCTTACTTCCACGATGCT
AACACCAAGCTTGCTCTTGAAGTCTAAAACAAGGGTCACAAGTTATAACCTACCTTCACC
GTTGGTGCTCAACGTAAGGTTAACAGCGACTTGACTGTTAAGGGTAAGGTCAACAACAAA
TTAGATTTATCTTTGGCCTCTAAGTACGCTCTTAACAGACAATTCACCCTCACTGCTGGT
CTCCAATTAGCCTTAAACGAAAAGAACATTGTTGATTTCAGCAAGTTCCCTCCCGTCCCC
TTCGGTTTACAATTAGAAACCAACTTTTGA


>TTHERM_00117590(protein)
MAQSLKLQPLTSLGTPNNVLSDDYVHGTFETYKFKASTTNGGKVDYKAKVATAQKDGKLA
VKVSDEGKIQFPFLDKYTFQFCQRRSGDVKLHFDLGNYTISGKSWNFFTNVKTDTTLSKF
NFRLGTNYFGSTCESNTRLELVPGDAPVLTHRNYIKKGSIYYGGVFSLNLQALALKRYDA
LFGYVNDKYEANLKHESDNKDTKDLQVGTLTATVSYFHDANTKLALEVQNKGHKLQPTFT
VGAQRKVNSDLTVKGKVNNKLDLSLASKYALNRQFTLTAGLQLALNEKNIVDFSKFPPVP
FGLQLETNF


>TTHERM_00117590(gene)
ATGGCTCAATCTTTAAAGCTTTAACCTTTAACCAGTCTTGGAACACCCAACAACGTTCTT
TCTGACGACTACGTTCACGGTACCTTCGAAACCTACAAGTTCAAGGCCAGCACCACCAAC
GGAGGTAAGGTTGACTACAAGGCTAAGGTTGCCACCGCTCAAAAGGATGGTAAGCTTGCT
GTCAAGGTCAGTGATGAAGGTAAAATCTAATTCCCCTTCCTCGACAAGTACACCTTCTAA
TTCTGTTAGAGAAGATCTGGTGATGTCAAGCTCCACTTCGACTTGGGTAACTACACCATT
TCCGGTAAATCATGGAACTTCTTCACTAACGTCAAGACCGATACCACCTTATCCAAGTTC
AATTTCAGATTAGGTACTAACTACTTTGGTAGCACTTGCGAATCTAACACCAGATTAGAA
TTAGTCCCTGGTGATGCTCCCGTCCTTACTCACAGAAACTACATCAAGAAGGGATCTATC
TACTACGGTGGTGTCTTCTCCCTTAACCTCTAAGCTTTAGCTTTAAAGAGATACGACGCT
CTCTTTGGTTACGTCAATGATAAGTATGAAGCTAACCTCAAGCACGAATCTGACAACAAG
GATACCAAGGATTTACAAGTAACTTTTATTTAAAAACAGCTATCTCAAATAGCATAAATA
TTCAATGAAATTAAGTAGAAAAGACATGTTTTTTTTATCAGGTTTTTAAATAATTTTAAA
TATTGCTTAGACATTTCAAACTTTCAAATAAGATATGACAAGAGATACTCATAAATAAAA
AAATATATTAAAAAATTATACACATAACCAATCTTCAATCTATTTTTTTTTGATAGCAAG
CAATAGAATTAATTATACAGTAAATATCTATGTTTGTTTGTTAATCAAACAATAAAGAAA
AAATAATTGAAATATCAGACAAACAGACAGACACAGTTAAGTAGGACTTTAAAAGCAAAT
TATGATAATCAAATCATTAAATTTATTTTAATAAATGAAATGTCAGTCGAAGCAGCATAA
ATATATGGTAAAATAAGAAGTCTATCCATAGGGGTATTTTTGACACTCATTTTTCAAAAT
TTTAAAACATTTTAAAATTTTGAAAAATGAGTGTCAAAAATACCCTATGGGATAGACTTC
TTATTTTACCATATATGCATAAACAGAGCTAAACAAATTTAATAAATATTAAAAGCTTAG
GATTAGAAAATTTTTTAAAAAGAAAAGCTAGTAAAATAAATTAATAAATAAATAAACAAA
AAACAGATTTTAAAATTCAAAAAATCTTAAATGACACAATAATCCTATTCACATCAATTC
CAATAAAAAAAATCACGTCACTTTTATCTCCTTAAATTTTTAAAATCTCTTAATAATTAA
TTATTCTTTTCGAAGTTTAATTTCATAAAAGTCATTCAGCTCTCATTGTATAAATAAATT
TAATTTAATAATATAGGTTGGTACTCTTACTGCTACTGTTTCTTACTTCCACGATGCTAA
CACCAAGCTTGCTCTTGAAGTCTAAAACAAGGGTCACAAGTTATAACCTACCTTCACCGT
TGGTGCTCAACGTAAGGTTAACAGCGACTTGACTGTTAAGGGTAAGGTCAACAACAAATT
AGATTTATCTTTGGCCTCTAAGTACGCTCTTAACAGACAATTCACCCTCACTGCTGGTCT
CCAATTAGCCTTAAACGAAAAGAACATTGTTGATTTCAGCAAGTTCCCTCCCGTCCCCTT
CGGTTTACAATTAGAAACCAACTTTTGA