Identifiers and Description

Gene Model Identifier

TTHERM_00190620

Standard Name

UTP7 (Predicted U3 snoRNP-associated protein Utp7)

Aliases

PreTt08713 | 15.m00424 | 3697.m00135

Description

Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08149 ) BING4CT (NUC141) domain
  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00190620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06236.19.997093137033517e-262hypothetical protein (526 aa)
OxytrichaContig13443.0.g1033.9984749229924286e-140BING4CT (NUC141) domain
SGDYER082C7.996200075452222e-123UTP7 Nucleolar protein, compon
ent of the small subunit (SSU)
processome containing the U3
snoRNA that is involved in pro
cessing of pre-18S rRNA
WormBaseWBGene000092116.997863935131626e-107locus:wdr-46 status:Confirme
d UniProt:Q19873 protein_i
d:CAA94597.1
DictyBaseDDB_G02804899.998496826795377e-105wdr46 on chromosome: 3 positio
n 3437042 to 3438999
Stentor CoeruleusSteCoe_304271.9503933001302485e-65

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00190620(coding)
ATGGATAAAAAGGACTCTTCATAAAGGTCGAGCTCTGCTGATTTATTTTAAATCAACAAG
AAGCTCAAATCATCTGATAAAAAGCTTAATTCTTAAATCAAAAAGACTCATTTTGTCTAG
CAACAAACTGAAAAATATGAAAAAATAAATCATTTACTTAAGCATGAAGAATAAGGGTAT
CTTGAAGCAGAAGGAATGGAGAAAACTTTAGCCTTCAAACAACATCAATTAAAAAATTTG
CTTCCTATTTAGAATGCTGAAAAAATTTTCGATTTAAAGCTTGACTGGGGATAGTATAGC
ATAGATTACACACGTAATGGTAACCATCTTTTACTTGGTGGATCCAAGGGTCATTTAGCT
ATGATGGATTGGCACGAAAAAAAGCTTGCTTGCGAAATTTAAGTAAAAGAATCTATCAGA
GATGTTAAATTCCTTCATGATGAAAAAATGTTTGCAGTAGCTTAAAAGAAGTATGTTTAT
GTTTATGATAATTAAGGTATTGAATTGCATAAGTTGAAAAGCCACCTAGAGCCTAGTCAT
TTAGAATATTTACCTTATCACTTTTTGTTGGTTTCCGCTAGCAGACTTGGTTTCTTAAAA
TATCATGACACATCTACTGGTTCTATAGTTGCTGAATATAGAATGAATGCCAGAGATCCT
GTTTGCATGAAGTAAAATCCATACAATGCTATTATTGGTGTTGGTGATAATAGAGGTTGT
GTTAATATGTATTCTCCTAATACAAGTGAACCTTTAGTTAAGATGTTATGTCATAAAGGA
AATGTTAATTCTCTTGCCTTTGATAAAAGAGGTTTCTATATGGTAACCGCTGGTACAGAT
GGTCTTTGGAAGGTTTGGGATTTAAGAACATACAAATTATTGCATGATTACTTTGCTCCT
TCAACTGTTTCACATTTGGATATTTCTCAAAGTGGAGTCCTTGCACTTTCTTATGGATGT
CGTACTTAACTTTGGAAGGACTGGTAACTTGAAAAATAAAAATAACCTTACATGAAGCAC
GAGTCATTTGGATACAACACAATAACAGACACTTAATTCGTGCCTTATGAAGATTTTCTT
GGTATAGGTATAGATGGAGGATTTTCAAGTATAGTTGTTCCTGGCTCAGGAGAAGCTAAT
TTCGATGCATTTGAATCAAACCCTTATTAAACTAAAAAGTAAGCTAGAGAAGGTCTTGTT
AAGAAATTACTTGAAAAGATTCCTAGCACTACAATTTCTTTGAACCCCAATAGAATTGGT
ACAATTGATACTGCAAGTAAAGAAGTTATAGAAGCAGAAGAAAAGGCTGAAAAGCAAGAA
AGAGAAAAGAATCAAATTAAGAAAAAGAAAAATAAAATGCGTGGCAAAAATAAATCTAGC
AAAGTAGAAGCAAGAAAGGAATTCAGCAGACAAGAAGAAAAGAGAGAAAAAGCTAAAGAA
GCTGTTGATATAAAAATCAGAGCTAGAAATGCAGAAAAAGAAAAAAAATCACAAGAATTA
AAAGTTTTAAATAAATTAGATTCAATCGACAACTTCGATCCTATTTATGCATTAAAAAAA
TAGAAAAAATTAAATTGA


>TTHERM_00190620(protein)
MDKKDSSQRSSSADLFQINKKLKSSDKKLNSQIKKTHFVQQQTEKYEKINHLLKHEEQGY
LEAEGMEKTLAFKQHQLKNLLPIQNAEKIFDLKLDWGQYSIDYTRNGNHLLLGGSKGHLA
MMDWHEKKLACEIQVKESIRDVKFLHDEKMFAVAQKKYVYVYDNQGIELHKLKSHLEPSH
LEYLPYHFLLVSASRLGFLKYHDTSTGSIVAEYRMNARDPVCMKQNPYNAIIGVGDNRGC
VNMYSPNTSEPLVKMLCHKGNVNSLAFDKRGFYMVTAGTDGLWKVWDLRTYKLLHDYFAP
STVSHLDISQSGVLALSYGCRTQLWKDWQLEKQKQPYMKHESFGYNTITDTQFVPYEDFL
GIGIDGGFSSIVVPGSGEANFDAFESNPYQTKKQAREGLVKKLLEKIPSTTISLNPNRIG
TIDTASKEVIEAEEKAEKQEREKNQIKKKKNKMRGKNKSSKVEARKEFSRQEEKREKAKE
AVDIKIRARNAEKEKKSQELKVLNKLDSIDNFDPIYALKKQKKLN


>TTHERM_00190620(gene)
ATGGATAAAAAGGACTCTTCATAAAGGTCGAGCTCTGCTGATTTATTTTAAATCAACAAG
AAGCTCAAATCATCTGATAAAAAGCTTAATTCTTAAATCAAAAAGACTCATTTTGTCTAG
CAACAAACTGAAAAATATGAAAAAATAAATCATTTACTTAAGCATGAAGAATAAGGGTAT
TTAGATATTTATTATTAATATGATTTAAAACATTATTAGCTCTAATTAAGTTCATTGCTT
TATTCTAAAATGAACAATGCAAAGTATATTTACTAAGATAATTTTATTGATAATTAAGGT
ATCTTGAAGCAGAAGGAATGGAGAAAACTTTAGCCTTCAAACAACATCAATTAAAAAATT
TGCTTCCTATTTAGAATGCTGAAAAAGTAGACTTTTGATAAATTATTAAATATGTTTCTG
AACATTTTTATAAAAAAAATAGATTTTCGATTTAAAGCTTGACTGGGGATAGTATAGCAT
AGATTACACACGTAATGGTAACCATCTTTTACTTGGTGGATCCAAGGGTCATTTAGCTAT
GATGGATTGGCACGAAAAAAAGCTTGCTTGCGAAATTTAAGTAAAAGAATCTATCAGAGA
TGTTAAATTCCTTCATGATGAAAAAATGTTTGCAGTAATAAATTGACAACAAAAACAGTT
AGTTAAATGAACAATCTTTATATATAAATAGGTAGCTTAAAAGAAGTATGTTTATGTTTA
TGATAATTAAGGTATTGAATTGCATAAGTTGAAAAGCCACCTAGAGCCTAGTCATTTAGA
ATATTTACCTTATCACTTTTTGTTGGTTTCCGCTAGCAGACTTGGTTTCTTAAAATATCA
TGACACATCTACTGGTTCTATAGTTGCTGGTAAGCAGATAGTTTATTTTATTTGTTGTAA
TTAGGTTATAATAAAAATATTATTATTTAAAAGAATATAGAATGAATGCCAGAGATCCTG
TTTGCATGAAGTAAAATCCATACAATGCTATTATTGGTGTTGGTGATAATAGAGGTTGTG
TTAATATGTATTCTCCTAATACAAGTGAACCTTTAGTTAAGATGTTATGTCATAAAGGAA
ATGTTAATTCTCTTGCCTTTGATAAAAGAGGTTTCTATATGGTAACCGCTGGTACAGATG
GTCTTTGGAAGGTTTGGGATTTAAGAACATACAAATTATTGCATGATTACTTTGCTCCTT
CAACTGTTTCACATTTGGATATTTCTCAAAGTGGAGTCCTTGCACTTTCTTATGGATGTC
GTACTTAACTTTGGAAGGACTGGTAACTTGAAAAATAAAAATAACCTTACATGAAGCACG
AGTCATTTGGATACAACACAATAACAGACACTTAATTCGTGCCTTATGAAGATTTTCTTG
GTATAGGTATAGATGGAGGATTTTCAAGTATAGTTGTTCCTGGCTCAGGAGAAGCTAATT
TCGATGCATTTGAATCAAACCCTTATTAAACTAAAAAGTAAGCTAGAGAAGGTCTTGTTA
AGAAATTACTTGAAAAGGTAAAAATTAAAATTTCTAACCAATAATAGTTATATTTATTAA
TATCGAAATAAATAAAAAGATTCCTAGCACTACAATTTCTTTGAACCCCAATAGAATTGG
TACAATTGATACTGCAAGTAAAGAAGTTATAGAAGCAGAAGAAAAGGCTGAAAAGCAAGA
AAGAGAAAAGAATCAAATTAAGAAAAAGAAAAATAAAATGCGTGGCAAAAATAAATCTAG
CAAAGTAGAAGCAAGAAAGGAATTCAGCAGACAAGAAGAAAAGAGAGAAAAAGCTAAAGA
AGCTGTTGATATAAAAATCAGAGCTAGAAATGCAGAAAAAGAAAAAAAATCACAAGAATT
AAAAGTTTTAAATAAATTAGATTCAATCGACAACTTCGATCCTATTTATGCATTAAAAAA
ATAGAAAAAATTAAATTGA