Identifiers and Description

Gene Model Identifier

TTHERM_00429830

Standard Name

UTP4 (Predicted U3 snoRNP protein Utp4 )

Aliases

PreTt26423 | 48.m00186 | 3831.m01529

Description

Subunit of U3-containing 90S preribosome and Small Subunit (SSU) processome complexes involved in production of 18S rRNA and assembly of small ribosomal subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00429830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04124.19.997093137033517e-262hypothetical protein (753 aa)
OxytrichaContig20958.0.g1051.9993430003514377e-39WD domain, G-beta repeat
SGDYDR324C1.0004572433669413e-23UTP4 Subunit of U3-containing
90S preribosome and Small Subu
nit (SSU) processome complexes
involved in production of 18S
rRNA and assembly of small ri
bosomal subunit; member of t-U
tp subcomplex involved with tr
anscription of 35S rRNA transc
ript
DictyBaseDDB_G02934621.9999391735788327e-19cirh1a on chromosome: 6 positi
on 2920900 to 2922589
Stentor CoeruleusSteCoe_42174.248354255291589e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00429830(coding)
ATGGAAATAGAAGATTCTAAATAAGTTTAAACTGAGGTATTGACCAAGACCAAAGCAATT
TAAAAAGAAAGCAAATCTTAAAATTCTGCAAATGATGCTATTGAAAGCTAATCTAAAAAT
GGCAAAAGCAAAGCAGGTAGCAAACAAGAAATTCCTAAGGAAGATTACAAGACCAAACTG
AAAATCTGCAAGTTTATTAAATTGTTCCCCTAATCGATTGAATGCATGGCTTATAGTGGT
AAGGAACTAAATTACGTTGCAGTTTCAAGAGCTGATTCTAGTATTGAAATATGGAGAAGT
ACTAATTGGTCTCAAATCATTAAATTTTAAAACAGTGAAGCTGAAAAGGCTGTCCATTTA
GTTTTTTATTATTTGGAAGACAGCAAATAGACAGTTCTTCTAGCTTTTTGTGCTAATGGT
TTGATTAAACTTTACGATTTCAATTCTCTTAAACCCAGACACGAATACACAAATCCTGGT
GGCTACATTTGGGGTATAAGCAAGAATCCTAACACTTAAGAAATATTAACAGCTTGTGAA
GATGGGTTTTTAAGAATATTCAATGTTGATGATGAATTAGGATTAAAAATAAGATTTGTT
TCAACAGTCAGAAATTTCGAGGAAAGAGCTATTGATGTTTGCTGGGATTGTGAGAACCCT
GAAGAGTTTTATGGCAGTTATGATAGTGGATTGATTCGTAAATTTAACAAAGCAAAGCAA
GTTGTAGCTACTATGAATGTAAAGGAGAACTATGAAAAAACTGTTGGCTGGCGTATATTA
AGTATGAAGGAAAACTAGTTAGTTGTTGGATGCAGCGATGGTCAAATCAGAATTTTTGAG
ACACGTTTTGGTACAGTTTTGAGATCTTTTAGAAAGCATGAAGCTGATGTGATGACTTTG
GCATACAATTAATCTAAAGACTGCTTTTATGCATCTGGCGCTGACTCTAAGATAGTTGTT
TTTAAGCTAATTAGAGGAGAATGGGTTTTGATTTCAGAAGACAGAGGTTAATCTCATGAT
ATTAAGAGTTTGATTCTGATCGATGAAGGTAATGCTCTCATTTCTGGTGGTTTGACTACT
GATATTTGCCAGTATGTGATTGAATAAGATGGTAAATTCTAGGAAAGAGCTGGGTTCAAG
AAAGGAGAAAAAAAGAAATTACGTCACATTCTAGGTCTTGACCAAAACTTAGAAAACTCT
TTGTAAATCACTCAAGACAACTTTTTACTCTTAAAAAAGGCTTTTTCAGTTGAATTGTGG
GAATTTGACACTGATAACTTAAATTACTAATTGTTGCTAGAAGTAAAGACTAAAAGCTAT
ATTTAGAGTGCTTCCCTTAGTGCTCTTGGAGAGTATCTTGCCTATTCAACTGAAAACGAA
ACCTACGTTTTCGGTTTAATGACTACAATTTCAGGAACTGGTTAAAAAAGTATTAAATTA
TAAAAATTATGCACACTTCCTCCTTAGATCTTTGTGAAATTTTCAGAAGGACAAGCTGTT
TCTCAATCAACAAGTAAAAACAGTGGTTTCTTGCTTATTCTTGACTTTTAGAGAAATCTC
TAAATGATTAAATTAACTGATTAATTCGATTTAACCTTGGAATAAATAGCTACTTTAGAT
GTAGAACTCTCCACAAGTCAGCATGTTGTATTGGGTCCTAAGAACAAGAGTGTATTTATA
GGATCAAAAATAAATAACACAATCGTAGAAATTGGCCTATCGACCAAGAATATGGGTAAC
GTATTATTTGAAGTTCCATAACTTTGCGAAGGCTTCCACTTTAATCACATCAAAGTACTT
CCCTCAACCAAATAGCTTGTCTTATCTTACGAAAACAGAAAATTCGCCATTTTCGATTTG
ATTACTAAATAACCAAGTAAATGGACAAAAGACAACTTCGACAAATTGCCTTAGTCTTAT
CTCAATCGTAATAACCACATTATGGGTATCTTAAAGCATCCTAAAGTACCTCGTAGAATC
ATCCTCTACACATCTGACTCATTCATAATTGTTGACCTCAACTCTAAAGCCCCTAAATAT
TCTATCTTCTAGCGTCCAGAACAGCCTGATAAAGAAGATATAAGCATTTCATTCACTATT
AAAGAATTCTCTAAGCCTGTAATTTTTGCAAGAGAAGGAGTTTCCAACTCTGATAAGATA
ATAAATGAAGATTCAAATAATATAATTCTATTCTAAATAGATTTTGCAGAGATGTTGGCT
AACCTTCCTGGAGCTGTTATGGCAAAGAAGTTCGGAAACTGA


>TTHERM_00429830(protein)
MEIEDSKQVQTEVLTKTKAIQKESKSQNSANDAIESQSKNGKSKAGSKQEIPKEDYKTKL
KICKFIKLFPQSIECMAYSGKELNYVAVSRADSSIEIWRSTNWSQIIKFQNSEAEKAVHL
VFYYLEDSKQTVLLAFCANGLIKLYDFNSLKPRHEYTNPGGYIWGISKNPNTQEILTACE
DGFLRIFNVDDELGLKIRFVSTVRNFEERAIDVCWDCENPEEFYGSYDSGLIRKFNKAKQ
VVATMNVKENYEKTVGWRILSMKENQLVVGCSDGQIRIFETRFGTVLRSFRKHEADVMTL
AYNQSKDCFYASGADSKIVVFKLIRGEWVLISEDRGQSHDIKSLILIDEGNALISGGLTT
DICQYVIEQDGKFQERAGFKKGEKKKLRHILGLDQNLENSLQITQDNFLLLKKAFSVELW
EFDTDNLNYQLLLEVKTKSYIQSASLSALGEYLAYSTENETYVFGLMTTISGTGQKSIKL
QKLCTLPPQIFVKFSEGQAVSQSTSKNSGFLLILDFQRNLQMIKLTDQFDLTLEQIATLD
VELSTSQHVVLGPKNKSVFIGSKINNTIVEIGLSTKNMGNVLFEVPQLCEGFHFNHIKVL
PSTKQLVLSYENRKFAIFDLITKQPSKWTKDNFDKLPQSYLNRNNHIMGILKHPKVPRRI
ILYTSDSFIIVDLNSKAPKYSIFQRPEQPDKEDISISFTIKEFSKPVIFAREGVSNSDKI
INEDSNNIILFQIDFAEMLANLPGAVMAKKFGN


>TTHERM_00429830(gene)
ATGGAAATAGAAGATTCTAAATAAGTTTAAACTGAGGTATTGACCAAGACCAAAGCAATT
TAAAAAGAAAGCAAATCTTAAAATTCTGCAAATGATGCTATTGAAAGCTAATCTAAAAAT
GGCAAAAGCAAAGCAGGTAGCAAACAAGAAATTCCTAAGGAAGATTACAAGACCAAACTG
AAAATCTGCAAGTTTATTAAATTGTTCCCCTAATCGATTGAATGCATGGCTTATAGTGGT
AAGGAACTAAATTACGTTGCAGTTTCAAGAGCTGATTCTAGTATTGAAATATGGAGAAGT
ACTAATTGGTCTCAAATCATTAAATTTTAAAACAGTGAAGCTGAAAAGGCTGTCCATTTA
GTTTTTTATTATTTGGAAGACAGCAAATAGACAGTTCTTCTAGCTTTTTGTGCTAATGGT
TTGATTAAACTTTACGATTTCAATTCTCTTAAACCCAGACACGAATACACAAATCCTGGT
GGCTACATTTGGGGTATAAGCAAGAATCCTAACACTTAAGAAATATTAACAGCTTGTGAA
GATGGGTTTTTAAGAATATTCAATGTTGATGATGAATTAGGATTAAAAATAAGATTTGTT
TCAACAGTCAGAAATTTCGAGGAAAGGTAAAAATTAATAAATTTATTTACATTTATTTAC
TAAAAGACAAAAATTTTAGAATATTTTGAAAATCAAACTAAATTATAAACAAGTAGAATT
ATAAAATCTTTTTAAAGCTATTCATTCCTCTTAGGTTAAATATAAAGCTGCAAATTTACA
TTCAAATATTAAATGATTTTGTTTCATGCTATCTTGTTCTAGCTCTTCCAACAAGCAACC
AAAATTATGAATTAAGATTCTATTTTAACCTTAGTTTTTTTACACTTTAAATAAAAAAAT
GTATTTATTTATTTTACAGTTTAACCATAATAAAGAATTTATTTTGCATAAATTCATAAT
GCAAATTAACCAAAATAAATAATTTATTTTGTAGTTTAATCAAAATAATAAATTTATTTT
ACTATTTAACCAAAATAATGAATTTGTCTTATAACTTTTTCATTAATATTTCATAATTTT
TTGAAATATAAAATAAATAATAATAATTGAAAATATTCCAAAACAAACAAACATTTTAAA
ATAAAAAACTTTTATAATATGCACAGTAAAATAAATAAAAATATTAATTTAATTGATTAG
AATTTTTCTGTACATTTAAAAATGCTTTTGATTTAAATATATTTAATTTTATTTTATTAG
AGCTATTGATGTTTGCTGGGATTGTGAGAACCCTGAAGAGTTTTATGGCAGTTATGATAG
TGGATTGATTCGTAAATTTAACAAAGCAAAGCAAGTTGTAGCTACTATGAATGTAAAGGA
GAACTATGAAAAAACTGTTGGCTGGCGTATATTAAGTATGAAGGAAAACTAGTTAGTTGT
TGGATGCAGCGATGGTCAAATCAGAATTTTTGAGACACGTTTTGGTACAGTTTTGAGATC
TTTTAGAAAGCATGAAGCTGATGTGATGACTTTGGCATACAATTAATCTAAAGACTGCTT
TTATGCATCTGGCGCTGACTCTAAGATAGTTGTTTTTAAGCTAATTAGAGGAGAATGGGT
TTTGATTTCAGAAGACAGAGGTTAATCTCATGATATTAAGAGTTTGATTCTGATCGATGA
AGGTAATGCTCTCATTTCTGGTGGTTTGACTACTGATATTTGCCAGTATGTGATTGAATA
AGATGGTAAATTCTAGGAAAGAGCTGGGTTCAAGAAAGGAGAAAAAAAGAAATTACGTCA
CATTCTAGGTCTTGACCAAAACTTAGAAAACTCTTTGTAAATCACTCAAGACAACTTTTT
ACTCTTAAAAAAGGCTTTTTCAGTTGAATTGTGGGAATTTGACACTGATAACTTAAATTA
CTAATTGTTGCTAGAAGTAAAGACTAAAAGCTATATTTAGAGTGCTTCCCTTAGTGCTCT
TGGAGAGTATCTTGCCTATTCAACTGAAAACGAAACCTACGTTTTCGGTTTAATGACTAC
AATTTCAGGAACTGGTTAAAAAAGTATTAAATTATAAAAATTATGCACACTTCCTCCTTA
GATCTTTGTGAAATTTTCAGAAGGACAAGCTGTTTCTCAATCAACAAGTAAAAACAGTGG
TTTCTTGCTTATTCTTGACTTTTAGAGAAATCTCTAAATGATTAAATTAACTGATTAATT
CGATTTAACCTTGGAATAAATAGCTACTTTAGATGTAGAACTCTCCACAAGTCAGCATGT
TGTATTGGGTCCTAAGAACAAGAGTGTATTTATAGGATCAAAAATAAATAACACAATCGT
AGAAATTGGCCTATCGACCAAGAATATGGGTAACGTATTATTTGAAGTTCCATAACTTTG
CGAAGGCTTCCACTTTAATCACATCAAAGTACTTCCCTCAACCAAATAGCTTGTCTTATC
TTACGAAAACAGAAAATTCGCCATTTTCGATTTGATTACTAAATAACCAAGTAAATGGAC
AAAAGACAACTTCGACAAATTGCCTTAGTCTTATCTCAATCGTAATAACCACATTATGGG
TATCTTAAAGCATCCTAAAGTACCTCGTAGAATCATCCTCTACACATCTGACTCATTCAT
AATTGTTGACCTCAACTCTAAAGCCCCTAAATATTCTATCTTCTAGCGTCCAGAACAGCC
TGATAAAGAAGATATAAGCATTTCATTCACTATTAAAGAATTCTCTAAGCCTGTAATTTT
TGCAAGAGAAGGAGTTTCCAACTCTGATAAGATAATAAATGAAGATTCAAATAATATAAT
TCTATTCTAAATAGATTTTGCAGAGATGTTGGCTAACCTTCCTGGAGCTGTTATGGCAAA
GAAGTTCGGAAACTGA