Identifiers and Description

Gene Model Identifier

TTHERM_00647070

Standard Name

UTP21 (Predicted U3 snoRNP protein Utp21)

Aliases

PreTt15813 | 93.m00109 | 3727.m00029

Description

Subunit of U3-containing 90S preribosome and Small Subunit (SSU) processome complexes involved in production of 18S rRNA and assembly of small ribosomal subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03178 ) CPSF A subunit region
  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF06430 ) Lactococcus lactis RepB C-terminus
  • ( PF04192 ) Utp21 specific WD40 associated domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00647070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18819.19.997093137033517e-262hypothetical protein (909 aa)
OxytrichaContig6655.0.g842.999277470785175e-69Utp21 specific WD40 associated
putative domain
SGDYLR409C9.999353957415832e-59UTP21 Subunit of U3-containing
90S preribosome and Small Sub
unit (SSU) processome complexe
s involved in production of 18
S rRNA and assembly of small r
ibosomal subunit; synthetic de
fect with STI1 Hsp90 cochapero
ne; human homolog linked to gl
aucoma
DictyBaseDDB_G02770193.0006824396935516e-51wdr36 on chromosome: 2 positio
n 7238641 to 7241913
WormBaseWBGene000128874.9986056260133516e-43status:Partially_confirmed U
niProt:O62477 protein_id:CAA
16382.5
Stentor CoeruleusSteCoe_135195.900090541597061e-29

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00647070(coding)
ATGGATTTAACAGATAAATTAGTATTAAGACCTTATAAATCATTAGGTGTGTTTTGCGAT
AGCAATTAGTAATTTTTGTACAATGCAGGTAATAAGCTTTATTTGGCTTCTACATGCGGT
CACTCATTTAAGACTTATACAATTCCTGAGATGAAAATATCTTTATTTGGTCCTCACTTT
GAAGGAAAATTGCGTGCTATTTAGGGTTTTAATGAATTTCTTTTTGTAGCAGTTAAAAAT
GTTGTTTACAAGATGAGACATTATCATATTTTAGGAGAAATGAAGATGGATGCTAAAATT
ACAACAATGCTTCTTATGGCTGACCAGATTGCTATAGTTGACTAGAACAATACATTAAAG
ATTTTTAATCATCATAGCAAAATTTGTGTAGCTACAGCTTAGTTTGATTTCAATGTTTAA
AGCATTATTCATCCTCCTACATATCTGAACAAGATTTTAATTATTGGAGAGAATAATGTT
GAATTATGGAATATAAATAGCATGAAAAAAATTTATGATTATTAGAATGTTTTGATAAAA
AATTATTGTGATGATAATACAATTCTTACAGTAGCAGAGCCTTCTCCAGTATTGAATGTT
ATTGCCTTCGCTTTTTCAAATGGAAAAATAGTCTTACACGATATTAAAAAAGATAAGACC
GTTGTTTCCTTCAAAATTAATCATAAGCCTCTATCTCTTTCCTTTTCAAAAGTAGACTAG
CCATTATTAGCAATAGGAGATGAAAAAGGATCTATAGTAATTTGGGATCTTAATGAAAAA
AAGATATTTGCTTCATTAAAATCTGTATTTTAGGGATCTGTTACATCTATAAACTTCATG
CCAAACGAGTAAGTTTTTATTGCTGCTTCAGGTAGAGACAATGCAGTTTTACAGTTTAGA
TATGAAGAATATGAAGAAAATAAGTTTGCAGTTTTAAGAAGACGTGAAGGTGTTATTGAC
TCATTAAAATAAGTTAGATTTGCTAACGATTTACATATCTTTGGCTGCACTAGCAATTAA
GAATCTGAAATTAGGGATTTCTCTATGATCAATGAGTGTATGAGTGTAACATTCTCTTCT
AAAGACTAAAGCAAAACTAAACTTAAGAGAAAGCATATTTACACAGAGTAAAATGCTGCT
TCAACAATAAATGAAATACTTGAGTTTTCTTTCTCGATGAACAGAGCTAATGATTGGGCT
AACGTCCTTACTTGTCATAAGGAAAGTGATAAGCCTTGCATTTGGTCAAGCGAAGATCAC
TCAATTATTAAAAAAGATTTAGTTTTATATGAGAACTCAAAGAGCAAAGAATAAAATTTC
TAGATTACAACTGTTTACGTGACCAAATGTGGTAACTTCGGTGTTCTTGGGCTAGATAAT
GGTAGAGTGATAAAGATAAATATGCAATCAGGTGCTTTTTAGAGAGCCTTTGCAGATGAG
CACGAAGGTTCTATAACTAGCATTTTTGTAAACAACTATAATAAATACTTGATCACTGCA
GACAATAATGGTAAAATGGTTATTTGGGATTTCTTTGCAGGTACTAAGCTGTCTGAAAAA
CAATATGAGAATGAGAAGATTGTATTTATTAGAGGGTCTAACTACTCTCATCACTTTTTA
GTTGCTTTGACTGATAACACTATAGAAATGTGGGATATGCTTAGCTTGAAAAGAGGTAGA
AAATTCGGTGGACATACATAAAAAATTTTAGATGCATGCTTTTCTCATAATAATAAGTAC
ATATTTTCTTCTTCATTAGATAGCACCTTAAAAGTTTATGATATTGCTTAAAATGACATT
ATTGCAAATCTTGAAGTTGAGCGCCCAATAATTTCTCTTGATAATTCTCCCAGTGGTGAG
TTTTTAATTACAGTATTCGCTAACTCAAGAGAAATCAATATCTGGCACAATCTTGTAGAA
ATATTACCTTGGGCTTCACCCTTGAAAAAGACAGTAAAATTCGTATCTCCCATAAAACAC
ACAGATATCGAAGACAGAAAGCGTTATTATCTTAATAACTCAATCAAGTAAGAGGAAGAT
GAATTAGAAGAACAGATGTTGTTGGAAGGCAAGGTTGATTACAAGATTGACCCAGTTAAT
AACAGCTTAAATATCATTAGATTCACTCAACTTGAAGATGGTAAATGGTTGCCTTTAATC
CACCTTGATGAAATAAAGGAAAGAAATAGATTAGAGAACAACGAAGAAATTGACTTCAAA
ATGCCTTTCTTCTTAGATTTTTCTAAAAAGGATGAAGTTAGAGATTAATTAAAGAAAGAA
TACCAATAAAAGGTATCTGAACAATCAAAAATTATTAAGGATAAGAAGGAAAAATATATG
AATGAATTGGGAAGCACAATTTAAAAGTTAGTCTTCGATTTCAAAGAAAAAAATTACAAC
AAATTCTTTGATGAATTAAAATCCCTTACTCCCAGTCAGGCAGACTATGAATTGAGACAA
GTTTTATTTGGAAACACTGATAATTCTATCATGAGAGTATTGACTTTCTTCAATCATCTC
TTTGATTCTACAGATGAGCTTGATCTTAAAAATGCATATTTCTCTCGTGTTATAAAGATT
TCTGGTGACGAGTTGATGAGAGATACTCAATACAAAGAAGTAATTGAATAAATTAGAAAT
AAAATTTAAAATAGCTGGTAGGCTTTAATGGATAAATAATATATTATTTCTAGCATGGCT
GAACATTTTGCTAGAATTCCTAATTGA


>TTHERM_00647070(protein)
MDLTDKLVLRPYKSLGVFCDSNQQFLYNAGNKLYLASTCGHSFKTYTIPEMKISLFGPHF
EGKLRAIQGFNEFLFVAVKNVVYKMRHYHILGEMKMDAKITTMLLMADQIAIVDQNNTLK
IFNHHSKICVATAQFDFNVQSIIHPPTYLNKILIIGENNVELWNINSMKKIYDYQNVLIK
NYCDDNTILTVAEPSPVLNVIAFAFSNGKIVLHDIKKDKTVVSFKINHKPLSLSFSKVDQ
PLLAIGDEKGSIVIWDLNEKKIFASLKSVFQGSVTSINFMPNEQVFIAASGRDNAVLQFR
YEEYEENKFAVLRRREGVIDSLKQVRFANDLHIFGCTSNQESEIRDFSMINECMSVTFSS
KDQSKTKLKRKHIYTEQNAASTINEILEFSFSMNRANDWANVLTCHKESDKPCIWSSEDH
SIIKKDLVLYENSKSKEQNFQITTVYVTKCGNFGVLGLDNGRVIKINMQSGAFQRAFADE
HEGSITSIFVNNYNKYLITADNNGKMVIWDFFAGTKLSEKQYENEKIVFIRGSNYSHHFL
VALTDNTIEMWDMLSLKRGRKFGGHTQKILDACFSHNNKYIFSSSLDSTLKVYDIAQNDI
IANLEVERPIISLDNSPSGEFLITVFANSREINIWHNLVEILPWASPLKKTVKFVSPIKH
TDIEDRKRYYLNNSIKQEEDELEEQMLLEGKVDYKIDPVNNSLNIIRFTQLEDGKWLPLI
HLDEIKERNRLENNEEIDFKMPFFLDFSKKDEVRDQLKKEYQQKVSEQSKIIKDKKEKYM
NELGSTIQKLVFDFKEKNYNKFFDELKSLTPSQADYELRQVLFGNTDNSIMRVLTFFNHL
FDSTDELDLKNAYFSRVIKISGDELMRDTQYKEVIEQIRNKIQNSWQALMDKQYIISSMA
EHFARIPN


>TTHERM_00647070(gene)
ATGGATTTAACAGATAAATTAGTATTAAGACCTTATAAATCATTAGGTGTGTTTTGCGAT
AGCAATTAGTAATTTTTGTACAATGCAGGTAATAAGCTTTATTTGGCTTCTACATGCGGT
CACTCATTTAAGACTTATACAATTCCTGAGATGAAAATATCTTTATTTGGTCCTCACTTT
GAAGGAAAATTGCGTGCTATTTAGGGTTTTAATGAATTTCTTTTTGTAGCAGTTAAAAAT
GTTGTTTACAAGATGAGACATTATCATATTTTAGGAGAAATGAAGATGGATGCTAAAATT
ACAACAATGCTTCTTATGGCTGACCAGATTGCTATAGTTGACTAGAACAATACATTAAAG
ATTTTTAATCATCATAGCAAAATTTGTGTAGCTACAGCTTAGTTTGATTTCAATGTTTAA
AGCATTATTCATCCTCCTACATATCTGAACAAGATTTTAATTATTGGAGAGAATAATGTT
GAATTATGGAATATAAATAGCATGAAAAAAATTTATGATTATTAGAATGTTTTGATAAAA
AATTATTGTGATGATAATACAATTCTTACAGTAGCAGAGCCTTCTCCAGTATTGAATGTT
ATTGCCTTCGCTTTTTCAAATGGAAAAATAGTCTTACACGATATTAAAAAAGATAAGACC
GTTGTTTCCTTCAAAATTAATCATAAGCCTCTATCTCTTTCCTTTTCAAAAGTAGACTAG
CCATTATTAGCAATAGGAGATGAAAAAGGATCTATAGTAATTTGGGATCTTAATGAAAAA
AAGATATTTGCTTCATTAAAATCTGTATTTTAGGGATCTGTTACATCTATAAACTTCATG
CCAAACGAGTAAGTTTTTATTGCTGCTTCAGGTAGAGACAATGCAGTTTTACAGGTAATC
AATTTCAAAAGGAATATTTTCAAAGATATTTATTTGGTTTTTACTTAGTATAAAAATACT
AAAAGTAAATAAGTAGAAATTAGATTTGATAAACATACAAAATTAAAATGAATCCAATTT
TAAATTAAAAAGAAAACAATTAATGATAAAATCATTTCAAGATATTATTTTTTGATTTAA
TCCACAAAGAATTTTGTTTTTTTTAAATGATTTTCAAACTATTTTTAAATTTGAAGAAAA
ATATTTGATTTTTTATATAAATTGGCTCATTTAATATGTAAATTAAGTTTAAATTTCATT
TTAAAAATAGTTTAGATATGAAGAATATGAAGAAAATAAGTTTGCAGTTTTAAGAAGACG
TGAAGGTGTTATTGACTCATTAAAATAAGTTAGATTTGCTAACGATTTACATATCTTTGG
CTGCACTAGCAATTAAGAATCTGAAATTAGGGATTTCTCTATGATCAATGAGTGTATGAG
TGTAACATTCTCTTCTAAAGACTAAAGCAAAACTAAACTTAAGAGAAAGCATATTTACAC
AGAGTAAAATGCTGCTTCAACAATAAATGAAATACTTGAGTTTTCTTTCTCGATGAACAG
AGCTAATGATTGGGCTAACGTCCTTACTTGTCATAAGGAAAGTGATAAGCCTTGCATTTG
GTCAAGCGAAGATCACTCAATTATTAAAAAAGATTTAGTTTTATATGAGAACTCAAAGAG
CAAAGGTAACAAATAACAATCTTGTTTGATATTCTTAAATATATTCAAACATTATTTATA
AAAACTAAAAAAAGAACCAAAAATTTTATAACAAAAAATTTTTTACAATATTTTACAATA
GACAAACCAATATCAAAGCTTAGCAAGCATTTATACATTTAATAATAAGATTATTTACTT
TTATTTTTGCAATAAATTTTGATATAAGCTATTATTGATTATCATAGAAATCAAATTAAA
TTGTTTGACTTAAAATCTTATTTGCTGATTGATTGATTGATTTATTTGTCTAGAGAGGAT
TTAAAATTAATTGGTTCAAAATAGAATTTTTTAAAAGCAGGAATTATTAAATATTTTAAA
TAATTTTAATTTTATTAGAATAAAATTTCTAGATTACAACTGTTTACGTGACCAAATGTG
GTAACTTCGGTGTTCTTGGGCTAGATAATGGTAGAGTGATAAAGATAAATATGCAATCAG
GTGCTTTTTAGAGAGCCTTTGCAGATGAGCACGAAGGTTCTATAACTAGCATTTTTGTAA
ACAACTATAATAAATACTTGATCACTGCAGACAATAATGGTAAAATGGTTATTTGGGATT
TCTTTGCAGGTACTAAGCTGTCTGAAAAACAATATGAGAATGAGAAGATTGTATTTATTA
GAGGGTCTAACTACTCTCATCACTTTTTAGTTGCTTTGACTGATAACACTATAGAAATGT
GGGATATGCTTAGCTTGAAAAGAGGTAGAAAATTCGGTGGACATACATAAAAAATTTTAG
ATGCATGCTTTTCTCATAATAATAAGTACATATTTTCTTCTTCATTAGATAGCACCTTAA
AAGTTTATGATATTGCTTAAAATGACATTATTGCAAATCTTGAAGTTGAGCGCCCAATAA
TTTCTCTTGATAATTCTCCCAGTGGTGAGTTTTTAATTACAGTATTCGCTAACTCAAGAG
AAATCAATATCTGGCACAATCTTGTAGAAATATTACCTTGGGCTTCACCCTTGAAAAAGA
CAGTAAAATTCGTATCTCCCATAAAACACACAGATATCGAAGACAGAAAGCGTTATTATC
TTAATAACTCAATCAAGGTAATAAATATATTTATAAATAACCAAAAGATACAATTAAAAA
AATACTATTCGTCTATAAATATTTTAAGAGTTTTTCTATTAGAAAAATTTCCCCAACAAA
GAAAGGATGAAATAATGTAAAGAAGATACTAATTAATTAATAATGACAGAAAGCATGAAA
AAAAAAACCAAAAAGATATGCTTATTAAACTATTTATTGAATTTGATATTTAGATTTATT
ATTATTTTTGGTTCAACTGCTGACATTTTATTATATAAAAATAAATAGTAAGAGGAAGAT
GAATTAGAAGAACAGATGTTGTTGGAAGGCAAGGTTGATTACAAGATTGACCCAGTTAAT
AACAGCTTAAATATCATTAGATTCACTCAACTTGAAGATGGTAAATGGTTGCCTTTAATC
CACCTTGATGAAATAAAGGAAAGAAATAGATTAGAGAACAACGAAGAAATTGACTTCAAA
ATGCCTTTCTTCTTAGATTTTTCTAAAAAGGATGAAGTTAGAGATTAATTAAAGAAAGAA
TACCAATAAAAGGTATCTGAACAATCAAAAATTATTAAGGATAAGAAGGAAAAATATATG
AATGAATTGGGAAGCACAATTTAAAAGTTAGTCTTCGATTTCAAAGAAAAAAATTACAAC
AAATTCTTTGATGAATTAAAATCCCTTACTCCCAGTCAGGCAGACTATGAATTGAGACAA
GTTTTATTTGGAAACACTGATAATTCTATCATGAGAGTATTGACTTTCTTCAATCATCTC
TTTGATTCTACAGATGAGCTTGATCTTAAAAATGCATATTTCTCTCGTGTTATAAAGGTA
ATTAAAATATTTACTTGATTATTTTCTATTTATTTCTTCACAATTTGATCAATCAATCAA
TTTATTGAATATGATATCTAATATCCATTAATTTTAATGCAATAGTTAATTCTCATTTTA
ATTTAAAACCCAAAATTATTCACTTGAAATGAATTATTGTTCATTTTATAATGATTCAAC
TAAAAATTTTTTAGACTTAGCCTTTATTTATTGTAAGCTCTCAAATTCAGAGATATTTGT
ATCTGTTTTTTCCTTAATGAAAAAAATTCTAAAAAAGAAAAAATGATTGATTGGATTTAA
ATCACTAAATAAAATTAAATAAATAAAAGAAATTTTTATCGAAGGACTAAATGAAATTTT
ATAAATTAATTTGAAAGTAGAAATATTTTTTAATTAAATCAAATTATAAATTTAACATGA
AAAGTCTGCAATATATTTTTATTCATATTAATTGAACCATAATAATTCTTTGATATTAAT
ATTTATTTCTTTAATAGATTTCTGGTGACGAGTTGATGAGAGATACTCAATACAAAGAAG
TAATTGAATAAATTAGAAATAAAATTTAAAATAGCTGGTAGGCTTTAATGGATAAATAAT
ATATTATTTCTAGCATGGCTGAACATTTTGCTAGAATTCCTAATTGA