Identifiers and Description

Gene Model Identifier

TTHERM_00557930

Standard Name

UTP20 (U3 snoRNP protein Utp20 (predicted))

Aliases

PreTt07891 | 73.m00135 | 3735.m00029

Description

Component of the small-subunit (SSU) processome, which is involved in the biogenesis of the 18S rRNA

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00557930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14359.19.997093137033517e-262down-regulated in metastasis f
amily protein (3113 aa)
DictyBaseDDB_G02790832.0008536325002377e-42utp20 on chromosome: 3 positio
n 1583286 to 1592966
OxytrichaContig17073.0.g531.9994920269952867e-34hypothetical protein
SGDYBL004W1.9996410647472548e-29UTP20 Component of the small-s
ubunit (SSU) processome, which
is involved in the biogenesis
of the 18S rRNA
WormBaseWBGene000070505.002171138422328e-22locus:tag-184 status:Partial
ly_confirmed UniProt:Q19545
protein_id:CCD68194.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00557930(coding)
ATGGTCAAATTTATTCCCACAAAAAGAACAACAAAGAATTTGTCAGTCGAGGAATTCTGG
CAAGTCAAACAAAAATTAAAACCCAGAGATGCTGAAAAATTAAAAAGACGTGTTTAAGTA
GACTTATCAGGTCGTTATAAATTTAAGTCTTTCAAGAAAGAAATTCAAAACATAGATGTT
AGCTTGACTCATTTTATAGACGAAATCAAGCAATAGCCTTATAGTTAAACTGATGATAAT
TTAGGTTCCTACTTTTTGGATGAGCTAGAACTTTAACATGCCAAGTGCAAAACACCATAT
TATAAAAAATTCTATACATAGGTAGTAGATCTTTCTTAAAGTTTACCTTTAGTCCTCCAT
AACTTGGATTATATAATAAGTCTTATTGTAGACAATTTAAATCTCCCTGAAGTCTCATTA
CAAGATGTCAAAAAAAATATCAAAGGAGGCAAAAGTAAATAAGTTGTTTAATTAGAAGCA
TCTTTTGATGATGATGATGAAGATGAAGAAGGATAAATGGATGTGGCATAAATTGCATTT
GATGAAGAAGAATAAGATGATGATGAAGATGACTTAGACGATGCCATAAAGTTAAATTAA
GACATGCAAGCATAAGCTAAGTAGCAAATGGAATCTGAAGAAGATCCTGACGTTGCAAAA
GTAAGAAGAAGACTAATGACACCTTATATGCTATAATTACTTCCTGAGATTATCAGAGAT
TGTTAAGATTTGGCTTACAAGGTATTTATTGATAAGGTCTTCTTCAGAATCACTGACTTA
ATTGATTTAAAGAACCTTCCTTAGCTCTAATTAATTTATAAAGTATTAGCTTATTCATTA
AAATATTTCTACAGAGAAATTTTAAATAACTTTGAAGAATTTTTGGGTTTGTATTTCAAC
AAGCTATTTTTACATAAAAATAAATATGTAAGATAATTTTCTAGTGAGTCCTTCTCGTAT
ATTATTAAAAAAATGACTTAAAAAGAAAGATTGTAAAAGGTTCCTAAGATTTTCGAAATG
ATTAGAAATAAATGTGTAGAACTTAGGTAAGAGACTGAATAAGACTAAACATTATAAAAA
TATAAAGTTCTTTAGGAGTAGTATTTAAAAGATAGCGTTAGTCATATGTTATTCAGTTGT
TTAATTGGTATGCATAGATTCATGACTTATAGAGGCATGGACTAATTCAAAGAAATTATT
GAAATCATTTTAAGCCAAGGAAAGGACAATAATGATATCCAGTATGTTTTAGGCTAATAT
CTCGAATATTCATACAAGCATTTTACAATTGAGTAACAAGCAGATAAATTGTGCTTTAAC
CTAACTGATCTTTTTAATGCATTGAGTTTAATTCTTTCTAAAAATGTTACTGTTGATTAA
GAAGGATTTTCTCTTATATTAAGAAATATTTGCTCAAAGATTATCGATTTCCTTGATTAT
AAAGACGCTATTAATTTGGATGAAAAGAATGCTCCTCACATTATTGAAATGCTTAGAGTT
ATGATTGATTATCAAAATAAGTATCCAGATCAATAGTTAAAAAATAGTATTTCTGGTTCT
ATTGGTAGACTTTTTAAGAGGGGATTCAGCTCTTATTCTTCAAGCATTCTTACACCAGAA
GTCAATGATTTCTTACTTGAAAAGTTAAGCATTTTAGAGACATTTGAGTTCTTTAAATTA
CTCATTTTCCCCTATGAAGGTAAAAAAGAAGACGTTGACAGAGCTTATACTTTCGAAGAA
GGCATCTACGACTATTGTTTGATTTTAGCTTTCCGTCATATTGACAAGTTATTCGAAAGA
CGAGCTGCTGATGATAAAGAAGATGTCCAAAAAACTCTCCACTGCATGTTCTTTATGATG
ACTATGATACATGAATAAAGTTTTTCTTATAAAAAATTATAGCTTAAAAGTTCTTAAGTT
CTTTTAAATGTTGCATTAAATAAACTTTAAAACTTACTTGAAAATTATATTTCCTATTTA
AATAACCCAAGTCCTGCTAAAGAATAAATTACTGAAGCCAAAAGATGTTACAGAGAAATG
ATCATCTTTACAAAATTATCACAATTTTCTGATTTCAAGAGCCAAGAATTAATTAATAAG
TATGAATAGTTAATTAAAATAATAAATACTTAACTTCAATAGAAGAGTGAAGAGTTAGGC
ACATAGGATTTTGAAGAAGACAAATTTATTGATTCAAACGAATTATATAATTTCCGTGAA
AGTATAGTTAAGAAGTACGAGTTGAAGAGCTCAATAGTTAACTCTACCTAAAAACTTTCA
CTCTTAAAAAGCGAAATGCTCATATATGTCAGCTCTAATCTTTAGGAAAAAACAAATGAA
TAATTAATTGCATTTGAAATTTCATATTTAAATAAATATGTTGAAAATCCTAATTACTTA
AAGAACTTCGCAATTTTCTTGTAAAACACAAAGAGAAAATTAACAGTCGATGAGCATGAG
TAGTTCTTCTATCAACTTTGTCGTAACTTAAGAAGCAAATACACCGAAACAAGACTCGCT
TCACTTTAAGTTTTAAATTTATTCTAAAAATTAGAGTATCTGCAAGTTAATGTTTAATCT
AATAATGAAACTATTCCTTCTGTTTTAAGAGGAGAGATCAATATGATTGAAATGCTGCTC
TATATATAAAACTAAATTCCTTCTATTGACAACGAAAGAAACATCAAGTTAGAACTAATG
AGAATGAAAACAAACGCATACGCTTATCCACCTATTTATCATTATTTATTATTTAACTTC
TGTCTTGGTTATATGTTTGTTAGATTTGCTCTCTTATGGCCTATTACTAAAGAAATTATT
ACCCACTTATTCAATCTTAGGAAGCACCCTCATATTCCTTATATCTTCTTGAATATGTTG
GCATATTACAACTATTAATTATCTCCATAATTCATAAGCAAATATAATAATGCTGATTAG
CTCTTTGAAGACATTGAAGAAAACGAGGAAGAGGAGGATGATGAAGAAGAAGAAAATGAA
GATGAATAAGGTGATAATTAGTAAAACAATAACAAAATGGAAATCGAATTACAATAAGGA
GAATCTGACTTCTTTGATAGTCTTTTTAACGATTATTATTTATTTGAAGGAGATGTTATT
GAAAATAAACTAGTGTTTGAGAATGTGTTCAAGGCTTTGAGTGAAAGTAAAAGGGAATCA
ATTGATGCAATAGTAAAATAATAAATAATTTGCCTCATGAAACAATTCTTTGAAAATGAA
CACCGTGAAATCGAGTTCATAATATAAGATTACTAATAATTAACTGAATTATAAATTGTA
TCACGCTAGTTAGATAACTAGATAGCAATTAACAAGAATTTATATGTCAAATACACTCAT
TTTTTATAAATTTTTATCAACTTCATTAGTGTTAAAGACATTGAAAAATAACACTTCTAT
GAAATATTCCTTGAATTATTACGTAAGAACAAGGAAAATATTTAATAATTAGCACTTGAC
TGCATTTTGAAATTTGAAAAGGCTTCATTACATAAATACCAATAAAGTCTTAAGTAATTA
ACAAAGAAGGAAAACTTGCGTAGAGAAATGCTCAACCTTAATTTAAATAGAGACTCTAAG
TAAATAGAAGATAGTCACAGAGTTGATGTTATTCCTGTTATTATCAACATTTTGTATCCT
CACTTATTTACCAAAAAAGGCAGTCATCATAAATCAAAGAAACATAGTGAATTATAACGT
AATGTAATTTACGGTTTCTTTTCTTCCCTCTAGCCTAATGAATTAGGGTATGTCATCGAT
TTAGTATTTAAGAATTTCCATATTCCTGACTTCACAAATGATTCAGTTATTCTTACTAAC
TAAAAAGAGCTTTTACAACTTCATTTGAATAAAATTTCTCAATTCAATATCAACATTAAG
AATATGATGTAAAAGTTAGGTTTGTTGCTTAAACCTTTCTTCAATCGTATTTTTAATTAT
CTTTTGTCTCTATTCAGCTCTTGTCAAACCTTAAAGAGTTAGATTAAGTAGGCTAAAAAT
AATCAATAAATGTTTGAATCTGAAGAAAACAAAGTAAATCGTATTTATAAATCAGTCAAG
AAATTACAAAAGCAAGCCCTCGAAAGATATAGTGAGATTTGCCGCAGATATCGCAATCAA
TTGAGTGGATCATAAGATTTTGTTGAAAATTTCTTGTAAATTATGGATAATAAGATTTAA
ATGCTTCGTTAAGACACTGTAACTAGTGTGCCAGGTGTTCTAAAAATTATGAGTATTTGG
TCATAAGACTCTTAATTCTATTAATACTTCTTGAAATACGAATATATTATCCCAATTTTG
ATATCTCTTTACAATAGAGAAAAAATAAATGTTTAAATTATTTAGCTTGTACACAATATC
TTTTCTCAGCTTTTAGGCATTCAATCAAGCATCGATAAGAAAAATAAATCTGAAGAAGAA
ATGGAAGAAGAGGAAGAAGATGAAGAAAATGGTATTGAAGATGATGATGAAGATATTGAT
AGTGAAGATTAAGATGAAATGGATGTCGAAGAAGATGAAGATTTTGATGAAAAAAATAAT
TAGTAATTAAAGATTACTAAATCCATTATGAAAACTACAAAGGGAGCCTCTGCTGACCAA
GATGTGAAATAGAAAATCAGCGAATTTATGAAATAACATTACAACTCTTTGTTAGAAAGC
ATGTATTCTTATCTTGAATTTAATCTTGCTCCTAGTTAATTGATCAAAAGAAACAAACAA
AAGAAAATTGATTCATTGAGTCTTGAAATCATTGATCATATCAGTTCTAATATTGAGTCA
ATTGAAGAAAGTTTGAGTTTTAAGTATTTAAATTACTTCATCAAATTCCTTGATGCTGCA
AATGTCAAAAAACTTAAAGATGTTGCATCTACTCCTTCTACATCAAGTACCGAAGAAAAT
AGTAATAAGAAAGGAAAAACTAGACAATAAGAGTTAGGCGATAAGTTTAATATTTTCTAC
AAAGTTTTAAGCATAAATAATAACTTTTTAAGACTAAATAAAGACAATACATCCTTTTAT
AAACCATTTATTAGCATTTTACCTTTCACTTAGTCTGAAGAATTCAAAAAACTTGCAGTC
AAGTGTATTACTTCTCTCAAGCTACCTTTCCACAATGATTAAATCATTGAAGTACTTTAA
GATATGTCAGTATTTGAAAGAACGATGAAACAAACCTTGAACTACGATAAATTCCTTGAC
GCTGTCTATAAGGTTAATACTGAGTACATGAAAGAATGGTTTAAAGGAGATTTAAGATGT
GTAGAGACTTACTTTATGATGTTAATGAGTTCATGTGCTGACTCAGAAATGAGTGTCAGA
ATGGCCATTAATAGCTCATTTGATACTCTATTCAAGCTAATTACTGAAAATCAAGAAAAC
CTCTCAGAAGAAAATATTCAAACAATAAAAGCCTATTTATTCTTCAAGCTTTTACCTTTT
GTCGCTAAAGAACTTAGAAAAACAAAGGATGAATATGTTGTCAAAAATGTTATTCAAATA
CTCAAGCTTTATTTGTAATTCATTCCCTCAATCAAGATTGAAAACTTCTTCTAAACTGAT
AGTTTTAATTATATCGAATTACGTGCTTTGATACACACCGATGAAAATCAAGATTTCTTT
GAATGTATTACTCATATTTAAATGAATAAGAGAATTAAAGGTATGAATATTCTCATGAAG
ACTGTAGAGTAAATTAATGACTAATCAAACGTTTGGAATATTGTATTACCTATTATTGAA
TGGATTATCCTTTACAAATGCTAAGAAATATATAAGGCTAACAATAAAACCAAATTAACT
GATATTACTTTGTAACACTACAAGTTACTTTTATAATCTGCTATCAATACTATTGGCATA
ATATCAAAAAATTTATCTGTAGCTAAGGTCAAAAAAATCCTTAAGAAATATGTTTAATTC
CTTAGTAACAAGAAATTTGATTAGAAGATTACTATTAAAGTACTTGGATCTGTATTAGAA
ACTTTGAACCTACCTTATAATATTGTTAGCGAAGTCAATAGAGAAATGGAAAATATTTAG
GAGAAGAAAATGGAAAATACTTTGCTTTATGATATGATTCAAAAGAACAAAGAATATGAT
AACCCTAATTAAGATTTGTAAGAAGACGAAGAACCAGTAGAAAACAATGATTTAGCTGAA
GTCTAGCCCTATGATTTAGTTCTGGATGAAAAATTAGACACAAACATTAAGGAGAAATGG
ATTGAAAATTTGGAAAGAGAGAAGTTTTACATTAAAAATCAAGAACTCGAATTAGATTAG
ATTGCAAGCAAAGATAGCGATATGTCTAATTATTACAGATTCTTAAGATTATAAGTCTTC
TTGCCAATGAAATAACTACTATTCGATTAATACTCAAAGGCTTATAACAAATTTGCTAAA
GTCACTTTAGATGACAAATAAAAAAATAAATAAGATGAAAAGATCAGAATTTTCATGACC
ATAGCTCTTATTAAGCTTTTAATTAAGTTCCCTAAAGAAATTTTCAGAATCGAATTCCCT
AAGCTTGTAAATAAAGTTGTTAAAAATTTACGTACTAAGGATAATGATGAACGTAACTTC
ACTCGTAAAGTCCTCTTAGAAATCGTAAGAATGACTGGTCCTTACTTTTTCCATTACATC
GTAAAAGAATTAAAGTTCTTCCTCAAAAATGGATGGGAGTCTCATATTCTTAACTACACA
ATTTACACTTTGCTTACTGAATTAGACAACAAGAAGATACCTATTGGTAGTTTGGATTAT
TGTCACAGTGAAATATTCCCTCTCTTGGTTGATGAAATATTCGGAAAGCTCATGGAAGAA
AAAGACTTATAAATGACTAAGATTCCTGAATAAAAGAAAAATAAAGCAAATGCTACTTTC
TAATTATTTGCTAAAAATTTAGATTTCAGAAATGTTATCAATTTCTTAGCATTTGTTAGA
CAATAGCTTGTAGAAAATTTGGATGGTTCTAAAAACCTTGGTAAGTTTGAAGAATTGTTT
AACTTTATTTTGGAAGGTTTTGTTAAAAACGAGAGTGTTTAGCATACTGAATTAGTTACT
GTCAGTTATAGTTTGATTAAGGATGCTTTAGATTTGATTGAAAGCACCAAGAAAAAAGAC
AGACTAAATGATACAACAATAGCAGATTAAGTTATAGATAAGAAGTAGCTTACAAAGCAC
AATTTAGCTAAGACTTATGAAATTTTGGAAGTCACTGCTCAAAACAAATCCATTTTCTAA
TCTATTCAAGACTCAAAGAAAAAGAATAAATTTAAAATCGGATGCTGCATGTGTAACTTT
GGTTTAAAGATGTGTTTGATGGGTATTAAGAAGTCCATTTTCGCACCAGAATAAATTTCT
AATTAGATCCAATTCGAGCAACTAATTAAGGTTATTGTTGAGTGTCTCAAGTCAACAGAT
AATACTATGATTATTAGCAGTTTGAGAATTTTAAAAACTGTCATTACTAGGAAAGAAGCT
AAGGGAATTCGTAAAGCTACTGTATCAGCAGTACTTGCTATCTTGGAGAAATTAACTAAC
ACAGACATTGAGATGATTGGTGAAACATTTAAACTCATAAACACTATTATTGATCACTCT
CAAAACTCATTAAAGAATTCTTAATATAAAGCATTACTTTTGTATATCAAATAATTTTTG
GATGTCAGCGATTACTGTTCAGAACCATTAAATACTTTGAATACTATTATTGAAAAGAAA
CTTATTTATGAAGAAGTTTATGATTTGGTTAATTAAAAAGTAAGAGAAGCTATGATCCAA
TCTTATGCGCAAAACATAAATTCTATTTGCAAATAAATTTACTTGAATTTCTTGGTAAAG
TATCCTATTTCTGATACAATCATGCAATCTTCGATAAATTTCTTAATTAAAAATACCGAA
TATACTTACGACTAAGGTAGAATTATAGTTTATGACATCCTTAAAATCATTATCAAGAGT
TTCCCTGATAAAGTACTCACTTACTTTGGTGAAATCATTTATGTATCATACTTGGTAAAC
TTAATCAAAGAAGAAAACAAAGAAATCAGAGAAACTATTAAGCTTTCTTAACAACTGTTA
ATCAACAGACTTTCTAATGAATAAAAATAAAGATTGATTACTAACAATCTTCAATGGATA
ACTTAACATAATAATCCTAAAATTTAACAAAGCGGTTTTATTGGATTGCGCTTGTTTTTA
GAAGACAAACAAGACTTCCTTACTAAAGAAGAAGAAATTAAATTGTAAATAAGTCAAATT
TTTGACAGCAGAGAAGAGAGAATGAATATCTTTTGGGAAATTATTAAACAAAAGAAAGAA
AAGAAAGAAGCTCTTAAGAATTCAGAATGGAAAAACTTTATTGATACTGAAATAGAAGTA
GAAGAAAAATAAAATGAAAACGAATTGACTAATGATACTTTGTTAAATAGTGTTTTAGAA
TTTGTTTTAGCTTATAATAAATATTTGAAGGAAAGAGAATTGCCTAATACATTGATTTTT
GAAGGCAAAAGAAAGTTAATCTGCAATATTATTTAATATATCAATTTCCCTAATTAAGAC
ACTTCTAATTTAACTATGAATTGTTTGATGGAGTTAACTGAAACTAACTAAAGTATGGCA
TAGTAAGCCTTTAAGGATGGTATGCAAGTTGTTGTTTCACTGCTTCCTAAAGTTTTGAAA
TATTTATATTTCTCTAAACTTAAAAATAACTTTGTTATTTCTAATACTCAAAACTCTCAT
AAATTCTTCATATTTGTAATGAAGTTCTTCTTAAACTGTGATCAAGAAACGATTGCCATT
GCTTTGTTTGAAAATATCCTCAAAATCTTCTTAAGATCTTACATAAAAGCATATTACAAT
AAATCTTAAATAGAATATATTGTAGAATTGATTCTTCACTTGGCTCAAAACATGTCTTAA
GATGAAGATAAAGAACTTGTTAATGAAATTAAAAACTATATGTTGAAGAATGAAAGAGCA
TTAGAAATTGTTTTGGAAATTTTGATTAAGGTTAAGACTTTTGATAACAATAACAAGATT
TCTAACTAAGAGACTATTGAAAAAGCTGAATTGGCTATTGAGGAATTGAAGAAATCAATA
GAGTTGAATAACTTCTTCCAAATGTACTCAAAGGTAAAATCAGGAATTGAATCAATAAGA
TAAGAAAGAAAGCAACAATAAAAACAAGATATAATTACTAATCCAGAGGTTGCCTTTGAA
AAGAAGCAAGAGCAAAATCTTAAAAAGAGAAAAGCAAAACAAAATAAAATTAGAAATAGT
AAAAGATCTGAAAACATAGGCAGAAAGATTCTAAAAAAAGATTGA


>TTHERM_00557930(protein)
MVKFIPTKRTTKNLSVEEFWQVKQKLKPRDAEKLKRRVQVDLSGRYKFKSFKKEIQNIDV
SLTHFIDEIKQQPYSQTDDNLGSYFLDELELQHAKCKTPYYKKFYTQVVDLSQSLPLVLH
NLDYIISLIVDNLNLPEVSLQDVKKNIKGGKSKQVVQLEASFDDDDEDEEGQMDVAQIAF
DEEEQDDDEDDLDDAIKLNQDMQAQAKQQMESEEDPDVAKVRRRLMTPYMLQLLPEIIRD
CQDLAYKVFIDKVFFRITDLIDLKNLPQLQLIYKVLAYSLKYFYREILNNFEEFLGLYFN
KLFLHKNKYVRQFSSESFSYIIKKMTQKERLQKVPKIFEMIRNKCVELRQETEQDQTLQK
YKVLQEQYLKDSVSHMLFSCLIGMHRFMTYRGMDQFKEIIEIILSQGKDNNDIQYVLGQY
LEYSYKHFTIEQQADKLCFNLTDLFNALSLILSKNVTVDQEGFSLILRNICSKIIDFLDY
KDAINLDEKNAPHIIEMLRVMIDYQNKYPDQQLKNSISGSIGRLFKRGFSSYSSSILTPE
VNDFLLEKLSILETFEFFKLLIFPYEGKKEDVDRAYTFEEGIYDYCLILAFRHIDKLFER
RAADDKEDVQKTLHCMFFMMTMIHEQSFSYKKLQLKSSQVLLNVALNKLQNLLENYISYL
NNPSPAKEQITEAKRCYREMIIFTKLSQFSDFKSQELINKYEQLIKIINTQLQQKSEELG
TQDFEEDKFIDSNELYNFRESIVKKYELKSSIVNSTQKLSLLKSEMLIYVSSNLQEKTNE
QLIAFEISYLNKYVENPNYLKNFAIFLQNTKRKLTVDEHEQFFYQLCRNLRSKYTETRLA
SLQVLNLFQKLEYLQVNVQSNNETIPSVLRGEINMIEMLLYIQNQIPSIDNERNIKLELM
RMKTNAYAYPPIYHYLLFNFCLGYMFVRFALLWPITKEIITHLFNLRKHPHIPYIFLNML
AYYNYQLSPQFISKYNNADQLFEDIEENEEEEDDEEEENEDEQGDNQQNNNKMEIELQQG
ESDFFDSLFNDYYLFEGDVIENKLVFENVFKALSESKRESIDAIVKQQIICLMKQFFENE
HREIEFIIQDYQQLTELQIVSRQLDNQIAINKNLYVKYTHFLQIFINFISVKDIEKQHFY
EIFLELLRKNKENIQQLALDCILKFEKASLHKYQQSLKQLTKKENLRREMLNLNLNRDSK
QIEDSHRVDVIPVIINILYPHLFTKKGSHHKSKKHSELQRNVIYGFFSSLQPNELGYVID
LVFKNFHIPDFTNDSVILTNQKELLQLHLNKISQFNINIKNMMQKLGLLLKPFFNRIFNY
LLSLFSSCQTLKSQIKQAKNNQQMFESEENKVNRIYKSVKKLQKQALERYSEICRRYRNQ
LSGSQDFVENFLQIMDNKIQMLRQDTVTSVPGVLKIMSIWSQDSQFYQYFLKYEYIIPIL
ISLYNREKINVQIIQLVHNIFSQLLGIQSSIDKKNKSEEEMEEEEEDEENGIEDDDEDID
SEDQDEMDVEEDEDFDEKNNQQLKITKSIMKTTKGASADQDVKQKISEFMKQHYNSLLES
MYSYLEFNLAPSQLIKRNKQKKIDSLSLEIIDHISSNIESIEESLSFKYLNYFIKFLDAA
NVKKLKDVASTPSTSSTEENSNKKGKTRQQELGDKFNIFYKVLSINNNFLRLNKDNTSFY
KPFISILPFTQSEEFKKLAVKCITSLKLPFHNDQIIEVLQDMSVFERTMKQTLNYDKFLD
AVYKVNTEYMKEWFKGDLRCVETYFMMLMSSCADSEMSVRMAINSSFDTLFKLITENQEN
LSEENIQTIKAYLFFKLLPFVAKELRKTKDEYVVKNVIQILKLYLQFIPSIKIENFFQTD
SFNYIELRALIHTDENQDFFECITHIQMNKRIKGMNILMKTVEQINDQSNVWNIVLPIIE
WIILYKCQEIYKANNKTKLTDITLQHYKLLLQSAINTIGIISKNLSVAKVKKILKKYVQF
LSNKKFDQKITIKVLGSVLETLNLPYNIVSEVNREMENIQEKKMENTLLYDMIQKNKEYD
NPNQDLQEDEEPVENNDLAEVQPYDLVLDEKLDTNIKEKWIENLEREKFYIKNQELELDQ
IASKDSDMSNYYRFLRLQVFLPMKQLLFDQYSKAYNKFAKVTLDDKQKNKQDEKIRIFMT
IALIKLLIKFPKEIFRIEFPKLVNKVVKNLRTKDNDERNFTRKVLLEIVRMTGPYFFHYI
VKELKFFLKNGWESHILNYTIYTLLTELDNKKIPIGSLDYCHSEIFPLLVDEIFGKLMEE
KDLQMTKIPEQKKNKANATFQLFAKNLDFRNVINFLAFVRQQLVENLDGSKNLGKFEELF
NFILEGFVKNESVQHTELVTVSYSLIKDALDLIESTKKKDRLNDTTIADQVIDKKQLTKH
NLAKTYEILEVTAQNKSIFQSIQDSKKKNKFKIGCCMCNFGLKMCLMGIKKSIFAPEQIS
NQIQFEQLIKVIVECLKSTDNTMIISSLRILKTVITRKEAKGIRKATVSAVLAILEKLTN
TDIEMIGETFKLINTIIDHSQNSLKNSQYKALLLYIKQFLDVSDYCSEPLNTLNTIIEKK
LIYEEVYDLVNQKVREAMIQSYAQNINSICKQIYLNFLVKYPISDTIMQSSINFLIKNTE
YTYDQGRIIVYDILKIIIKSFPDKVLTYFGEIIYVSYLVNLIKEENKEIRETIKLSQQLL
INRLSNEQKQRLITNNLQWITQHNNPKIQQSGFIGLRLFLEDKQDFLTKEEEIKLQISQI
FDSREERMNIFWEIIKQKKEKKEALKNSEWKNFIDTEIEVEEKQNENELTNDTLLNSVLE
FVLAYNKYLKERELPNTLIFEGKRKLICNIIQYINFPNQDTSNLTMNCLMELTETNQSMA
QQAFKDGMQVVVSLLPKVLKYLYFSKLKNNFVISNTQNSHKFFIFVMKFFLNCDQETIAI
ALFENILKIFLRSYIKAYYNKSQIEYIVELILHLAQNMSQDEDKELVNEIKNYMLKNERA
LEIVLEILIKVKTFDNNNKISNQETIEKAELAIEELKKSIELNNFFQMYSKVKSGIESIR
QERKQQQKQDIITNPEVAFEKKQEQNLKKRKAKQNKIRNSKRSENIGRKILKKD


>TTHERM_00557930(gene)
ATGGTCAAATTTATTCCCACAAAAAGAACAACAAAGAATTTGTCAGTCGAGGAATTCTGG
CAAGTCAAACAAAAATTAAAACCCAGAGATGCTGAAAAATTAAAAAGACGTGTTTAAGTA
GACTTATCAGGTCGTTATAAATTTAAGTCTTTCAAGAAAGAAATTCAAAACATAGATGTT
AGCTTGACTCATTTTATAGACGAAATCAAGCAATAGCCTTATAGTTAAACTGATGATAAT
TTAGGTTCCTACTTTTTGGATGAGCTAGAACTTTAACATGCCAAGTGCAAAACACCATAT
TATAAAAAATTCTATACATAGGTAGTAGATCTTTCTTAAAGTTTACCTTTAGTCCTCCAT
AACTTGGATTATATAATAAGTCTTATTGTAGACAATTTAAATCTCCCTGAAGTCTCATTA
CAAGATGTCAAAAAAAATATCAAAGGAGGCAAAAGTAAATAAGTTGTTTAATTAGAAGCA
TCTTTTGATGATGATGATGAAGATGAAGAAGGATAAATGGATGTGGCATAAATTGCATTT
GATGAAGAAGAATAAGATGATGATGAAGATGACTTAGACGATGCCATAAAGTTAAATTAA
GACATGCAAGCATAAGCTAAGTAGCAAATGGAATCTGAAGAAGATCCTGACGTTGCAAAA
GTAAGAAGAAGACTAATGACACCTTATATGCTATAATTACTTCCTGAGATTATCAGAGAT
TGTTAAGATTTGGCTTACAAGGTATTTATTGATAAGGTCTTCTTCAGAATCACTGACTTA
ATTGATTTAAAGAACCTTCCTTAGCTCTAATTAATTTATAAAGTATTAGCTTATTCATTA
AAATATTTCTACAGAGAAATTTTAAGTAAGTTATTTTATTATCTCATTTTTATTTCAAAT
ACTCTCTAAATTTTATATGATTATCTACTAGCAAGTGAAAGATAAAAGATTTGCATGATC
ATAAACAACAACAATAAAAAAATAATGCAATAATAAAATGATCAGATTAAAAATATTAAA
ATTAATCAAATAAATATTTGAAAATGTTTTTTTGTTAATAATTAGTTTGAATTTTTTTAA
ATCAAAAGATATTTATTGATTTTATTTATCAATTTATTTTTAAATTAATAGATAACTTTG
AAGAATTTTTGGGTTTGTATTTCAACAAGCTATTTTTACATAAAAATAAATATGTAAGAT
AATTTTCTAGTGAGTCCTTCTCGTATATTATTAAAAAAATGACTTAAAAAGAAAGATTGT
AAAAGGTTCCTAAGATTTTCGAAATGATTAGAAATAAATGTGTAGAACTTAGGTAAGAGA
CTGAATAAGACTAAACATTATAAAAATATAAAGTTCTTTAGGAGTAGTATTTAAAAGATA
GCGTTAGTCATATGTTATTCAGTTGTTTAATTGGTATGCATAGATTCATGACTTATAGAG
GCATGGACTAATTCAAAGAAATTATTGAAATCATTTTAAGCCAAGGAAAGGACAATAATG
ATATCCAGTATGTTTTAGGCTAATATCTCGAATATTCATACAAGCATTTTACAATTGAGT
AACAAGCAGATAAATTGTGCTTTAACCTAACTGATCTTTTTAATGCATTGAGTTTAATTC
TTTCTAAAAATGTTACTGTTGATTAAGAAGGATTTTCTCTTATATTAAGAAATATTTGCT
CAAAGATTATCGATTTCCTTGATTATAAAGACGCTATTAATTTGGATGAAAAGAATGCTC
CTCACATTATTGAAATGCTTAGAGTTATGATTGATTATCAAAATAAGTATCCAGATCAAT
AGTTAAAAAATAGTATTTCTGGTTCTATTGGTAGACTTTTTAAGAGGGGATTCAGCTCTT
ATTCTTCAAGCATTCTTACACCAGAAGTCAATGATTTCTTACTTGAAAAGTTAAGCATTT
TAGAGACATTTGAGTTCTTTAAATTACTCATTTTCCCCTATGAAGGTAAAAAAGAAGACG
TTGACAGAGCTTATACTTTCGAAGAAGGCATCTACGACTATTGTTTGATTTTAGCTTTCC
GTCATATTGACAAGTTATTCGAAAGACGAGCTGCTGATGATAAAGAAGATGTCCAAAAAA
CTCTCCACTGCATGTTCTTTATGATGACTATGATACATGAATAAAGTTTTTCTTATAAAA
AATTATAGCTTAAAAGTTCTTAAGTTCTTTTAAATGTTGCATTAAATAAACTTTAAAACT
TACTTGAAAATTATATTTCCTATTTAAATAACCCAAGTCCTGCTAAAGAATAAATTACTG
AAGCCAAAAGATGTTACAGAGAAATGATCATCTTTACAAAATTATCACAATTTTCTGATT
TCAAGAGCCAAGAATTAATTAATAAGTATGAATAGTTAATTAAAATAATAAATACTTAAC
TTCAATAGAAGAGTGAAGAGTTAGGCACATAGGATTTTGAAGAAGACAAATTTATTGATT
CAAACGAATTATATAATTTCCGTGAAAGTATAGTTAAGAAGTACGAGTTGAAGAGCTCAA
TAGTTAACTCTACCTAAAAACTTTCACTCTTAAAAAGCGAAATGCTCATATATGTCAGCT
CTAATCTTTAGGAAAAAACAAATGAATAATTAATTGCATTTGAAATTTCATATTTAAATA
AATATGTTGAAAATCCTAATTACTTAAAGAACTTCGCAATTTTCTTGTAAAACACAAAGA
GAAAATTAACAGTCGATGAGCATGAGTAGTTCTTCTATCAACTTTGTCGTAACTTAAGAA
GCAAATACACCGAAACAAGACTCGCTTCACTTTAAGTTTTAAATTTATTCTAAAAATTAG
AGTATCTGCAAGTTAATGTTTAATCTAATAATGAAACTATTCCTTCTGTTTTAAGAGGAG
AGATCAATATGATTGAAATGCTGCTCTATATATAAAACTAAATTCCTTCTATTGACAACG
AAAGAAACATCAAGTTAGAACTAATGAGAATGAAAACAAACGCATACGCTTATCCACCTA
TTTATCATTATTTATTATTTAACTTCTGTCTTGGTTATATGTTTGTTAGATTTGCTCTCT
TATGGCCTATTACTAAAGAAATTATTACCCACTTATTCAATCTTAGGAAGCACCCTCATA
TTCCTTATATCTTCTTGAATATGTTGGCATATTACAACTATTAATTATCTCCATAATTCA
TAAGCAAATATAATAATGCTGATTAGCTCTTTGAAGACATTGAAGAAAACGAGGAAGAGG
AGGATGATGAAGAAGAAGAAAATGAAGATGAATAAGGTGATAATTAGTAAAACAATAACA
AAATGGAAATCGAATTACAATAAGGAGAATCTGACTTCTTTGATAGTCTTTTTAACGATT
ATTATTTATTTGAAGGAGATGTTATTGAAAATAAACTAGTGTTTGAGAATGTGTTCAAGG
CTTTGAGTGAAAGTAAAAGGGAATCAATTGATGCAATAGTAAAATAATAAATAATTTGCC
TCATGAAACAATTCTTTGAAAATGAACACCGTGAAATCGAGTTCATAATATAAGATTACT
AATAATTAACTGAATTATAAATTGTATCACGCTAGTTAGATAACTAGATAGCAATTAACA
AGAATTTATATGTCAAATACACTCATTTTTTATAAATTTTTATCAACTTCATTAGTGTTA
AAGACATTGAAAAATAACACTTCTATGAAATATTCCTTGAATTATTACGTAAGAACAAGG
AAAATATTTAATAATTAGCACTTGACTGCATTTTGAAATTTGAAAAGGCTTCATTACATA
AATACCAATAAAGTCTTAAGTAATTAACAAAGAAGGAAAACTTGCGTAGAGAAATGCTCA
ACCTTAATTTAAATAGAGACTCTAAGTAAATAGAAGATAGTCACAGAGTTGATGTTATTC
CTGTTATTATCAACATTTTGTATCCTCACTTATTTACCAAAAAAGGCAGTCATCATAAAT
CAAAGAAACATAGTGAATTATAACGTAATGTAATTTACGGTTTCTTTTCTTCCCTCTAGC
CTAATGAATTAGGGTATGTCATCGATTTAGTATTTAAGAATTTCCATATTCCTGACTTCA
CAAATGATTCAGTTATTCTTACTAACTAAAAAGAGCTTTTACAACTTCATTTGAATAAAA
TTTCTCAATTCAATATCAACATTAAGAATATGATGTAAAAGTTAGGTTTGTTGCTTAAAC
CTTTCTTCAATCGTATTTTTAATTATCTTTTGTCTCTATTCAGCTCTTGTCAAACCTTAA
AGAGTTAGATTAAGTAGGCTAAAAATAATCAATAAATGTTTGAATCTGAAGAAAACAAAG
TAAATCGTATTTATAAATCAGTCAAGAAATTACAAAAGCAAGCCCTCGAAAGATATAGTG
AGATTTGCCGCAGATATCGCAATCAATTGAGTGGATCATAAGATTTTGTTGAAAATTTCT
TGTAAATTATGGATAATAAGATTTAAATGCTTCGTTAAGACACTGTAACTAGTGTGCCAG
GTGTTCTAAAAATTATGAGTATTTGGTCATAAGACTCTTAATTCTATTAATACTTCTTGA
AATACGAATATATTATCCCAATTTTGATATCTCTTTACAATAGAGAAAAAATAAATGTTT
AAATTATTTAGCTTGTACACAATATCTTTTCTCAGCTTTTAGGCATTCAATCAAGCATCG
ATAAGAAAAATAAATCTGAAGAAGAAATGGAAGAAGAGGAAGAAGATGAAGAAAATGGTA
TTGAAGATGATGATGAAGATATTGATAGTGAAGATTAAGATGAAATGGATGTCGAAGAAG
ATGAAGATTTTGATGAAAAAAATAATTAGTAATTAAAGATTACTAAATCCATTATGAAAA
CTACAAAGGGAGCCTCTGCTGACCAAGATGTGAAATAGAAAATCAGCGAATTTATGAAAT
AACATTACAACTCTTTGTTAGAAAGCATGTATTCTTATCTTGAATTTAATCTTGCTCCTA
GTTAATTGATCAAAAGAAACAAACAAAAGAAAATTGATTCATTGAGTCTTGAAATCATTG
ATCATATCAGTTCTAATATTGAGTCAATTGAAGAAAGTTTGAGTTTTAAGTATTTAAATT
ACTTCATCAAATTCCTTGATGCTGCAAATGTCAAAAAACTTAAAGATGTTGCATCTACTC
CTTCTACATCAAGTACCGAAGAAAATAGTAATAAGAAAGGAAAAACTAGACAATAAGAGT
TAGGCGATAAGTTTAATATTTTCTACAAAGTTTTAAGCATAAATAATAACTTTTTAAGAC
TAAATAAAGACAATACATCCTTTTATAAACCATTTATTAGCATTTTACCTTTCACTTAGT
CTGAAGAATTCAAAAAACTTGCAGTCAAGTGTATTACTTCTCTCAAGCTACCTTTCCACA
ATGATTAAATCATTGAAGTACTTTAAGATATGTCAGTATTTGAAAGAACGATGAAACAAA
CCTTGAACTACGATAAATTCCTTGACGCTGTCTATAAGGTAATATACTTTTTAATTTTAA
TTTCAATATTTACTATTTAATAATTTAGGTTAATACTGAGTACATGAAAGAATGGTTTAA
AGGAGATTTAAGATGTGTAGAGACTTACTTTATGATGTTAATGAGTTCATGTGCTGACTC
AGAAATGAGTGTCAGAATGGCCATTAATAGCTCATTTGATACTCTATTCAAGCTAATTAC
TGAAAATCAAGAAAACCTCTCAGAAGAAAATATTCAAACAATAAAAGCCTATTTATTCTT
CAAGCTTTTACCTTTTGTCGCTAAAGAACTTAGAAAAACAAAGGATGAATATGTTGTCAA
AAATGTTATTCAAATACTCAAGCTTTATTTGTAATTCATTCCCTCAATCAAGGTAATTTT
AATTATTTAATAATTTTAGATGTATTTCCACCTTATCCTTTATATACATATTTATTTATT
CAAAACTTTGATAAAAAATCAAATTACAATAAATCATTATTCTTTATTAAAAAATAGATT
GAAAACTTCTTCTAAACTGATAGTTTTAATTATATCGAATTACGTGCTTTGATACACACC
GATGAAAATCAAGATTTCTTTGAATGTATTACTCATATTTAAATGAATAAGAGAATTAAA
GGTATGAATATTCTCATGAAGACTGTAGAGTAAATTAATGACTAATCAAACGTTTGGAAT
ATTGTATTACCTATTATTGAATGGATTATCCTTTACAAATGCTAAGAAATATATAAGGCT
AACAATAAAACCAAATTAACTGATATTACTTTGTAACACTACAAGTTACTTTTATAATCT
GCTATCAATACTATTGGCATAATATCAAAAAATTTATCTGTAGCTAAGGTCAAAAAAATC
CTTAAGAAATATGTTTAATTCCTTAGTAACAAGAAATTTGATTAGAAGATTACTATTAAA
GTACTTGGATCTGTATTAGAAACTTTGAACCTACCTTATAATATTGTTAGCGAAGTCAAT
AGAGAAATGGAAAATATTTAGGAGAAGAAAATGGAAAATACTTTGCTTTATGATATGATT
CAAAAGAACAAAGAATATGATAACCCTAATTAAGATTTGTAAGAAGACGAAGAACCAGTA
GAAAACAATGATTTAGCTGAAGTCTAGCCCTATGATTTAGTTCTGGATGGTAAACTTAAT
TAAATAATATTTGAAAGATTATATTAATTTATTTTTATAAAATAGAAAAATTAGACACAA
ACATTAAGGAGAAATGGATTGAAAATTTGGAAAGAGAGAAGTTTTACATTAAAAATCAAG
AACTCGAATTAGATTAGATTGCAAGCAAAGATAGCGATATGTCTAATTATTACAGATTCT
TAAGATTATAAGTCTTCTTGCCAATGAAATAACTACTATTCGATTAATACTCAAAGGCTT
ATAACAAATTTGCTAAAGTCACTTTAGATGACAAATAAAAAAATAAATAAGATGAAAAGA
TCAGAATTTTCATGACCATAGCTCTTATTAAGCTTTTAATTAAGTTCCCTAAAGAAATTT
TCAGAATCGAATTCCCTAAGCTTGTAAATAAAGTTGTTAAAAATTTACGTACTAAGGATA
ATGATGAACGTAACTTCACTCGTAAAGTCCTCTTAGAAATCGTAAGAATGACTGGTCCTT
ACTTTTTCCATTACATCGTAAAAGAATTAAAGTTCTTCCTCAAAAATGGATGGGAGTCTC
ATATTCTTAACTACACAATTTACACTTTGCTTACTGAATTAGACAACAAGAAGATACCTA
TTGGTAGTTTGGATTATTGTCACAGTGAAATATTCCCTCTCTTGGTTGATGAAATATTCG
GAAAGCTCATGGAAGAAAAAGACTTATAAATGACTAAGATTCCTGAATAAAAGAAAAATA
AAGCAAATGCTACTTTCTAATTATTTGCTAAAAATTTAGATTTCAGAAATGTTATCAATT
TCTTAGCATTTGTTAGACAATAGCTTGTAGAAAATTTGGATGGTTCTAAAAACCTTGGTA
AGTTTGAAGAATTGTTTAACTTTATTTTGGAAGGTTTTGTTAAAAACGAGAGTGTTTAGC
ATACTGAATTAGTTACTGTCAGTTATAGTTTGATTAAGGATGCTTTAGATTTGATTGAAA
GCACCAAGAAAAAAGACAGACTAAATGATACAACAATAGCAGATTAAGTTATAGATAAGA
AGTAGCTTACAAAGCACAATTTAGCTAAGACTTATGAAATTTTGGAAGTCACTGCTCAAA
ACAAATCCATTTTCTAATCTATTCAAGACTCAAAGAAAAAGAATAAATTTAAAATCGGAT
GCTGCATGTGTAACTTTGGTTTAAAGATGTGTTTGATGGGTATTAAGAAGTCCATTTTCG
CACCAGAATAAATTTCTAATTAGATCCAATTCGAGCAACTAATTAAGTAAAAATTTTTTT
TTTAATTTTTTAATTTAACTTAATTATATTCAATTTTAGGGTTATTGTTGAGTGTCTCAA
GTCAACAGATAATACTATGATTATTAGCAGTTTGAGAATTTTAAAAACTGTCATTACTAG
GAAAGAAGCTAAGGGAATTCGTAAAGCTACTGTATCAGCAGTACTTGCTATCTTGGAGAA
ATTAACTAACACAGACATTGAGATGATTGGTGAAACATTTAAACTCATAAACACTATTAT
TGATCACTCTCAAAACTCATTAAAGAATTCTTAATATAAAGGTAAAATAAAAATTTCAAA
AGTAAGTTAAAAATAATTTATAATTATTAAATGTAAAAGCATTACTTTTGTATATCAAAT
AATTTTTGGATGTCAGCGATTACTGTTCAGAACCATTAAATACTTTGAATACTATTATTG
AAAAGAAACTTATTTATGAAGAAGTTTATGATTTGGTTAATTAAAAAGTAAGAGAAGCTA
TGATCCAATCTTATGCGCAAAACATAAATTCTATTTGCAAATAAATTTACTTGAATTTCT
TGGTAAAGTATCCTATTTCTGATACAATCATGCAATCTTCGATAAATTTCTTAATTAAAA
ATACCGAATATACTTACGACTAAGGTAGAATTATAGTTTATGACATCCTTAAAATCATTA
TCAAGAGTTTCCCTGATAAAGTACTCACTTACTTTGGTGAAATCATTTATGTATCATACT
TGGTAAACTTAATCAAAGAAGAAAACAAAGAAATCAGAGAAACTATTAAGCTTTCTTAAC
AACTGTTAATCAACAGACTTTCTAATGAATAAAAATAAAGATTGATTACTAACAATCTTC
AATGGATAACTTAACATAATAATCCTAAAATTTAAGTAATAATTATCATTTTTAATAAAT
TTTTAATTTACAGTAATATTTTTAACAATAGCAAAGCGGTTTTATTGGATTGCGCTTGTT
TTTAGAAGACAAACAAGACTTCCTTACTAAAGAAGAAGAAATTGTAAAATAATTTGCATG
ATAAAACAATAAATAAATAATGAACTTTTATTTAATTTTTTTATAGAAATTGTAAATAAG
TCAAATTTTTGACAGCAGAGAAGAGAGAATGAATATCTTTTGGGAAATTATTAAACAAAA
GAAAGAAAAGAAAGAAGCTCTTAAGAATTCAGAATGGAAAAACTTTATTGATACTGAAAT
AGAAGTAGAAGAAAAATAAAATGAAAACGAATTGACTAATGATACTTTGTTAAATAGTGT
TTTAGAATTTGTTTTAGCTTATAATAAATATTTGAAGGAAAGAGAATTGCCTAATACATT
GATTTTTGAAGGCAAAAGAAAGTTAATCTGCAATATTATTTAATATATCAATTTCCCTAA
TTAAGACACTTCTAATTTAACTATGAATTGTTTGATGGAGTTAACTGAAACTAACTAAAG
TATGGCATAGTAAGCCTTTAAGGATGGTATGCAAGTTGTTGTTTCACTGCTTCCTAAAGT
TTTGAAATATTTATATTTCTCTAAACTTAAAAATAACTTTGTTATTTCTAATACTCAAAA
CTCTCATAAATTCTTCATATTTGTAATGAAGTTCTTCTTAAACTGTGATCAAGAAACGAT
TGCCATTGCTTTGTTTGAAAATATCCTCAAAATCTTCTTAAGATCTTACATAAAAGCATA
TTACAATAAATCTTAAATAGAATATATTGTAGAATTGATTCTTCACTTGGCTCAAAACAT
GTCTTAAGATGAAGATAAAGAACTTGTTAATGAAATTAAAAACTATATGTTGAAGAATGA
AAGAGCATTAGAAATTGTTTTGGAAATTTTGATTAAGGTTAAGACTTTTGATAACAATAA
CAAGATTTCTAACTAAGAGACTATTGAAAAAGCTGAATTGGTAAATTTTTTATTTGTAAA
ATAATTGACTATATTAATAATTATTTATTCATCTTAAAGGCTATTGAGGAATTGAAGAAA
TCAATAGAGTTGAATAACTTCTTCCAAATGTACTCAAAGGTAAAATCAGGAATTGAATCA
ATAAGATAAGAAAGAAAGCAACAATAAAAACAAGATATAATTACTAATCCAGAGGTTGCC
TTTGAAAAGAAGCAAGAGCAAAATCTTAAAAAGAGAAAAGCAAAACAAAATAAAATTAGA
AATAGTAAAAGATCTGAAAACATAGGCAGAAAGATTCTAAAAAAAGATTGA